[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : fabF
DDBJ      :fabF         3-oxoacyl-[acyl carrier protein] synthase II
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  860/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:428 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->426 1b3nA PDBj e-109 52.6 %
:RPS:PDB   2->426 2c9hA PDBj 3e-95 45.8 %
:RPS:SCOP  8->268 1dd8A1  c.95.1.1 * 7e-77 31.9 %
:RPS:SCOP  267->426 1b3nA2  c.95.1.1 * 6e-42 54.4 %
:HMM:SCOP  8->268 2ix4A1 c.95.1.1 * 2.4e-72 39.8 %
:HMM:SCOP  228->426 1tqyA2 c.95.1.1 * 3.3e-66 47.2 %
:RPS:PFM   9->261 PF00109 * ketoacyl-synt 9e-21 32.0 %
:RPS:PFM   289->384 PF02801 * Ketoacyl-synt_C 2e-18 46.9 %
:HMM:PFM   8->261 PF00109 * ketoacyl-synt 1.1e-61 33.5 239/253  
:HMM:PFM   269->384 PF02801 * Ketoacyl-synt_C 4.5e-39 41.4 116/119  
:BLT:SWISS 8->424 FABF_RHIME e-115 55.0 %
:PROS 168->184|PS00606|B_KETOACYL_SYNTHASE
:PROS 337->344|PS00867|CPSASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03724.1 GT:GENE fabF GT:PRODUCT 3-oxoacyl-[acyl carrier protein] synthase II GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1085599..1086885 GB:FROM 1085599 GB:TO 1086885 GB:DIRECTION + GB:GENE fabF GB:PRODUCT 3-oxoacyl-[acyl carrier protein] synthase II GB:PROTEIN_ID AAL03724.1 GB:DB_XREF GI:15620315 GB:GENE:GENE fabF LENGTH 428 SQ:AASEQ MSNQRVNKRVVITGLGLVTPVGLNVSSSWKNIVDGVSGIKTITEFDTSKLACKIAGLIDNSEKDGFKLENFIQADDINRLSKMDKFIHYGVAAATEAVEDSGWLPDDEKSRDRTGLILGSGIGGLKMIEDTSIKLYQENNGKVSPFFIPASLINLLSGLVSIKYGFSGPNQTAVTACSTGAHAIGDAMRMIKHGYADVMIAGGAEAPVTPVGVAGFVAARALCTKYNDNPKKASRPWDKDRSGFVMGEGAGVVVLEEYEHALNRGAKVYGEVIGYGSTGDAYHMTAPHPEGRGAYRAMRDAMLDATITPDMIDYINAHGTSTTLGDGIELAAVQKLFLEANPKVLMSSTKSSIGHLLGAAGSVEFIFSALAIRDQIAPPTLNLDTPMDEVNIDLVALKAKKTKIDYVLSNSFGFGGTNASLVIKSILV GT:EXON 1|1-428:0| BL:SWS:NREP 1 BL:SWS:REP 8->424|FABF_RHIME|e-115|55.0|413/421| PROS 168->184|PS00606|B_KETOACYL_SYNTHASE|PDOC00529| PROS 337->344|PS00867|CPSASE_2|PDOC00676| SEG 115->125|glilgsgiggl| BL:PDB:NREP 1 BL:PDB:REP 8->426|1b3nA|e-109|52.6|409/411| RP:PDB:NREP 1 RP:PDB:REP 2->426|2c9hA|3e-95|45.8|419/426| RP:PFM:NREP 2 RP:PFM:REP 9->261|PF00109|9e-21|32.0|241/245|ketoacyl-synt| RP:PFM:REP 289->384|PF02801|2e-18|46.9|96/118|Ketoacyl-synt_C| HM:PFM:NREP 2 HM:PFM:REP 8->261|PF00109|1.1e-61|33.5|239/253|ketoacyl-synt| HM:PFM:REP 269->384|PF02801|4.5e-39|41.4|116/119|Ketoacyl-synt_C| RP:SCP:NREP 2 RP:SCP:REP 8->268|1dd8A1|7e-77|31.9|251/253|c.95.1.1| RP:SCP:REP 267->426|1b3nA2|6e-42|54.4|160/161|c.95.1.1| HM:SCP:REP 8->268|2ix4A1|2.4e-72|39.8|256/0|c.95.1.1|1/1|Thiolase-like| HM:SCP:REP 228->426|1tqyA2|3.3e-66|47.2|199/205|c.95.1.1|1/1|Thiolase-like| OP:NHOMO 4215 OP:NHOMOORG 1047 OP:PATTERN -------------------------------------------------------------------- 2371K2322221-1EDDKK-KCCCT9KJKKKEFDCD74472QFO1111121123211411NJ21U5SYHU3--------1112111111114111111-257553J66241111111111111111111211111122255111J346456691111222211322EDCW51111111111111111111121N1111111121111111211471121114111111111A3111111111111111111112-111111-1-11111111111111122211111241111111111111111111111111111111111111431111111111M1551111112--1211211311111111111111317222233333754334344633333333333333-4464654447425668446555554853253433333441111111113322213111111111111111111111111111111211112221553342GE99B83345EEED2I564222312568123324336742332223411122221223225143251243142221353632B463313aM331321111111111111111111111334432275335466666566666666666661-22221111111B293243255A288322-522222323353522222433483B9422222222222222225223222221747567656565112435333766742B5611113111111133111441132214A44358D66352622879411111111234481222224654443333333322222212--1111--------1-1-------------------------1111111111192 1152fs3-311-1127CH9SGIMRfUV222454KM96BBC99B344LIEMFEECB9RNE878111112-1111113112111111121-224C122----124111-273N43243-2121222412215A2-1231111222411211-31142632122228715547A54872345*736798459K473362333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 425 STR:RPRED 99.3 SQ:SECSTR #ccccccccEEEEEEEEEETTEEcHHHHHHHHHTTcccEEEcccGGGTTccccEEEccccccTTcccGGGTccTTHHHHHTTccHHHHHHHHHHHHHHHHHTcccccHHHHHTEEEEEEEccccHHHHHHHHHHHHHHcGGGccTTHHHHHcTTHHHHHHHHHHTccccEEccccGGHHHHHHHHHHHHHHHHTcccEEEEEEEEccccHHHHHHHHHTTcccccccccTTTcccTTcTTccccccccEEEEEEEEEHHHHHHHTccccEEEEEEEEEEcccccccccTTcHHHHHHHHHHHHHHTccGGGEEEEEccccccHHHHHHHHHHHHHHHGGGGGTcEEEccHHHHcccGGGHHHHHHHHHHHHHHHTEEcccTTcccccTTccccccccccEEccccEEEEEEEETTTEEEEEEEEcc## DISOP:02AL 1-6| PSIPRED cccccccccEEEEEEEEEccccccHHHHHHHHHccccccccccccccccccccEEEEEcccccccccHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHcccccHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHcccccEEEEccccHHccHHHHHHHHHcccccccccccccccccccccccccEEEEccEEEEEEEcHHHHHHcccEEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccHHHccEEEEccccccccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHEEEccc //