[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : fumC
DDBJ      :fumC         fumarate hydratase
Swiss-Prot:FUMC_RICCN   RecName: Full=Fumarate hydratase class II;         Short=Fumarase C;         EC=4.2.1.2;

Homologs  Archaea  39/68 : Bacteria  738/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
a.127.1
:463 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->457 3gtdA PDBj 0.0 94.9 %
:RPS:PDB   3->460 3e04A PDBj e-135 59.3 %
:RPS:SCOP  5->459 1fuoA  a.127.1.1 * e-146 54.7 %
:HMM:SCOP  4->462 1j3uA_ a.127.1.1 * 3.9e-163 40.6 %
:RPS:PFM   22->341 PF00206 * Lyase_1 9e-59 48.1 %
:RPS:PFM   408->461 PF10415 * FumaraseC_C 6e-17 70.4 %
:HMM:PFM   12->342 PF00206 * Lyase_1 5.4e-114 50.3 310/312  
:HMM:PFM   408->461 PF10415 * FumaraseC_C 2e-28 66.7 54/55  
:BLT:SWISS 1->463 FUMC_RICCN 0.0 100.0 %
:PROS 317->326|PS00163|FUMARATE_LYASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03550.1 GT:GENE fumC GT:PRODUCT fumarate hydratase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 937493..938884 GB:FROM 937493 GB:TO 938884 GB:DIRECTION + GB:GENE fumC GB:PRODUCT fumarate hydratase GB:PROTEIN_ID AAL03550.1 GB:DB_XREF GI:15620127 GB:GENE:GENE fumC LENGTH 463 SQ:AASEQ MKNYRTESDSFGEIQIEEKFYWGAQTQRSLENFKIGKQKMPEILIRALAILKKCAAQVNHEFGDLEAKIAISIDKATDRILEGEFEDNFPLVVWQTGSGTQTNMNMNEVIASIANEELTGKKGGKSPVHPNDHVNKGQSSNDSFPTAMHIATVLATKQQLIPALNNILTSLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIENALQKVYLLAQGGTAVGTGINSKIGFDIKFAEKVAEFTKQPFKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHLPENEPGSSIMPGKVNPTQVEALTMVCSQVMGNHVTVTIAGSNGHLELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINDLRDKSLMLVTALNPHIGYDNAAKIAKEAHKHGITLKEAAKKLNLLSEAKFDKIVVPEKMVSQS GT:EXON 1|1-463:0| SW:ID FUMC_RICCN SW:DE RecName: Full=Fumarate hydratase class II; Short=Fumarase C; EC=4.2.1.2; SW:GN Name=fumC; OrderedLocusNames=RC1012; SW:KW Complete proteome; Cytoplasm; Lyase; Tricarboxylic acid cycle. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->463|FUMC_RICCN|0.0|100.0|463/463| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| PROS 317->326|PS00163|FUMARATE_LYASES|PDOC00147| SEG 173->184|dkskdwdkiiki| BL:PDB:NREP 1 BL:PDB:REP 3->457|3gtdA|0.0|94.9|455/455| RP:PDB:NREP 1 RP:PDB:REP 3->460|3e04A|e-135|59.3|452/456| RP:PFM:NREP 2 RP:PFM:REP 22->341|PF00206|9e-59|48.1|293/302|Lyase_1| RP:PFM:REP 408->461|PF10415|6e-17|70.4|54/55|FumaraseC_C| HM:PFM:NREP 2 HM:PFM:REP 12->342|PF00206|5.4e-114|50.3|310/312|Lyase_1| HM:PFM:REP 408->461|PF10415|2e-28|66.7|54/55|FumaraseC_C| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00206|IPR000362| GO:PFM GO:0006099|"GO:tricarboxylic acid cycle"|PF10415|IPR018951| GO:PFM GO:0016829|"GO:lyase activity"|PF10415|IPR018951| RP:SCP:NREP 1 RP:SCP:REP 5->459|1fuoA|e-146|54.7|455/456|a.127.1.1| HM:SCP:REP 4->462|1j3uA_|3.9e-163|40.6|458/462|a.127.1.1|1/1|L-aspartase-like| OP:NHOMO 1468 OP:NHOMOORG 956 OP:PATTERN 11----2111111112-111----111111111-1111-----------111-1-----11211--11 1111122222322211111-11111211111111111246111112212222323111--11121132111-111111----1-1-1-1111-211--1322111111111-1-11-11111111---111---1111111---1111111111111111121111111111111111111111111111--22444444342344444223332443-1221111111112111111111111111111111-112222-111221122-11211-----------------------------------------------1--23------------22-----1-221---1111-1-11-11111---211111211112123111112111122222222221-3323322221112222232214112111111311121121111111111111211111111111111111111111111111-12-111-111112222221111111121111112211212-2111-11122112222111-1-212222222111122212-2223-323321111111122221212-42142122222221222222211--111222111111112222212----11---1222-21111------22222222222222222-2222422222222222222222332222222222222222222222222222222222222222211211111111111121322222222222222222222-2122213333344323333233211111111111113222222221111111111111111----222222--------1---------------------------111111111121- ----211-----1121111111111111111111111111111111111112121111111111211112113121111112122111-12111111111111221-1212121-111112--111121291-21111111111-1111111111111221-12112512712331-12S222113--31311131113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 463 STR:RPRED 100.0 SQ:SECSTR HHcEEEEEETTEEEEEETTccccHHHHHHHHHccccGGcccHHHHHHHHHHHHHHHHHGGGGTccHHHHHHHHHHHHHHHHTTccGGGccccccccTTcHHHHHHHHHHHHHHHHHHTTccTTcccccccccccTTTccHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTTTcEEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHHHHHTcTTTcEEcTTcTTTcccTTccTTHHHHHHHHHHHHHTcccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHTGGGcEEcHHHHHHHHHHccGGGGGGHHHHcHHHHHHHHHHHHHHTccHHHHHHHHTcccHHHHHHHccGGGccTTH DISOP:02AL 1-2, 462-463| PSIPRED cccccEEEcccccccccHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHccHHHHcccc //