[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : gatC
DDBJ      :gatC         glutamyl-tRNA amidotransferase subunit C
Swiss-Prot:GATC_RICCN   RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;         Short=Glu-ADT subunit C;         EC=6.3.5.-;

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.137.12
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->115 2g5hC PDBj 9e-07 32.3 %
:RPS:PDB   53->151 2dqnC PDBj 1e-19 26.9 %
:RPS:SCOP  53->151 2df4C1  a.137.12.1 * 1e-19 26.9 %
:HMM:SCOP  52->149 2f2aC1 a.137.12.1 * 2e-23 44.6 %
:HMM:PFM   69->133 PF02686 * Glu-tRNAGln 2.9e-22 35.4 65/72  
:HMM:PFM   24->94 PF06133 * DUF964 0.00012 21.1 71/108  
:BLT:SWISS 52->151 GATC_RICCN 4e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02733.1 GT:GENE gatC GT:PRODUCT glutamyl-tRNA amidotransferase subunit C GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(203286..203741) GB:FROM 203286 GB:TO 203741 GB:DIRECTION - GB:GENE gatC GB:PRODUCT glutamyl-tRNA amidotransferase subunit C GB:PROTEIN_ID AAL02733.1 GB:DB_XREF GI:15619245 GB:GENE:GENE gatC LENGTH 151 SQ:AASEQ MSHAIKSAIESCITGCIQDLAHKSQDDRNTVTNRQAFTGITSDYTTQNNKTMITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELLDNVSGNSAQLAKEVKYFITPKVVE GT:EXON 1|1-151:0| SW:ID GATC_RICCN SW:DE RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C; Short=Glu-ADT subunit C; EC=6.3.5.-; SW:GN Name=gatC; OrderedLocusNames=RC0195; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 52->151|GATC_RICCN|4e-52|100.0|100/100| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 51->115|2g5hC|9e-07|32.3|65/99| RP:PDB:NREP 1 RP:PDB:REP 53->151|2dqnC|1e-19|26.9|93/98| HM:PFM:NREP 2 HM:PFM:REP 69->133|PF02686|2.9e-22|35.4|65/72|Glu-tRNAGln| HM:PFM:REP 24->94|PF06133|0.00012|21.1|71/108|DUF964| RP:SCP:NREP 1 RP:SCP:REP 53->151|2df4C1|1e-19|26.9|93/99|a.137.12.1| HM:SCP:REP 52->149|2f2aC1|2e-23|44.6|92/0|a.137.12.1|1/1|Glu-tRNAGln amidotransferase C subunit| OP:NHOMO 83 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------1----------------------------------------------11------------------------1------------11-11---1------------------------------------------------------------------------------------1111--111------1----------1-----------------------11--------------------------------------------1---111--11-1------1111-------1-----11111111111---------111----1------1---11-1111111111---------------1----------111111111111111----11----------------------------------------------------------------------1-------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 66.9 SQ:SECSTR ##################################################ccccHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHGGGGGcccTTccccccccccccccccccccccccHHHHHTTccHHTTcccccccccccccccc DISOP:02AL 1-5, 42-51| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHHccccccccEEcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcHHHHccHHccccEEEcccccc //