[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : gidB
DDBJ      :gidB         glucose inhibited division protein B
Swiss-Prot:RSMG_RICCN   RecName: Full=Ribosomal RNA small subunit methyltransferase G;         EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase;         Short=16S rRNA m7G methyltransferase;

Homologs  Archaea  0/68 : Bacteria  165/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:192 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->99 1xdzA PDBj 5e-10 28.7 %
:RPS:SCOP  3->185 1jsxA  c.66.1.20 * 1e-26 25.4 %
:HMM:SCOP  1->165 1xdzA_ c.66.1.20 * 6.3e-24 27.4 %
:RPS:PFM   10->163 PF02527 * GidB 2e-18 35.7 %
:HMM:PFM   9->179 PF02527 * GidB 9.6e-52 32.2 171/184  
:BLT:SWISS 1->192 RSMG_RICCN e-100 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02623.1 GT:GENE gidB GT:PRODUCT glucose inhibited division protein B GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 78820..79398 GB:FROM 78820 GB:TO 79398 GB:DIRECTION + GB:GENE gidB GB:PRODUCT glucose inhibited division protein B GB:PROTEIN_ID AAL02623.1 GB:DB_XREF GI:15619123 GB:GENE:GENE gidB LENGTH 192 SQ:AASEQ MMEVPREIIEKLEIFQKLVKKWNKSINLVSDNTIHNFWQRHILDSLQLIQYIDNKEIHLVDIGSGSGLPGIVLSIAGVAQVSLIEADLRKCIFLEKASKISNNNIQIINQRIEKVEIDCSILTCRAFSNLNTIFNCIKNISVREKFLLLKGKNYLTEIVEAKERWLFGYLIHQSITCEEGKILEVSNLTKMI GT:EXON 1|1-192:0| SW:ID RSMG_RICCN SW:DE RecName: Full=Ribosomal RNA small subunit methyltransferase G; EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase; Short=16S rRNA m7G methyltransferase; SW:GN Name=rsmG; OrderedLocusNames=RC0085; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|RSMG_RICCN|e-100|100.0|192/192| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 100->110|isnnniqiinq| BL:PDB:NREP 1 BL:PDB:REP 5->99|1xdzA|5e-10|28.7|94/238| RP:PFM:NREP 1 RP:PFM:REP 10->163|PF02527|2e-18|35.7|154/183|GidB| HM:PFM:NREP 1 HM:PFM:REP 9->179|PF02527|9.6e-52|32.2|171/184|GidB| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF02527|IPR003682| GO:PFM GO:0006364|"GO:rRNA processing"|PF02527|IPR003682| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF02527|IPR003682| RP:SCP:NREP 1 RP:SCP:REP 3->185|1jsxA|1e-26|25.4|169/193|c.66.1.20| HM:SCP:REP 1->165|1xdzA_|6.3e-24|27.4|164/0|c.66.1.20|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 167 OP:NHOMOORG 167 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1-------------------1-111----1---------------------------------------------------1-----------------------------1-----1--------------------------------------------------------------------------------------------------------------------------------------------------1-------1-11---------1------------1-------1------1--111111111111111111111111111111-11111111111111111111111111111111111-1111111111111111111----------111111-11111111-----1-1-1-------------------------------------1--------------11--1-111111111---1--------------------------------1-----------------------------1----1-----------------------1111---------------------------------------------------1------------------------------------------111111111-1---111--------1-------------------1--1-111-------------------------------------------1-1--------------------------1-1-------1-1----------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 83.3 SQ:SECSTR ####HHHH#HHHHHHHHHHHHHHHHccccccccHHHHHHHTHHHHHGGGGTccGGGccEEEEcccccTTHHHHHHHTTcEEEEEEccHHHHHHHHHHHHTTcccEEEEEccTTTccccEEEEEccccccHHHHHHHHTTcEEEEEEEEEEccccHHHHHTccTTE########################### PSIPRED cccccHHHHHHHHHHHHHHHHHHHccccEEcccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHccccEEEEEEccHHHHHHHHHHHHcccccEEEEEEEHHHccccccEEEEcccccHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEcc //