[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : himD
DDBJ      :himD         integration host factor beta-subunit
Swiss-Prot:DBHL_RICCN   RecName: Full=DNA-binding protein HU-like;

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.55.1
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->60 1huuC PDBj 6e-08 41.9 %
:RPS:PDB   2->57 3c4iB PDBj 3e-09 27.3 %
:RPS:SCOP  3->58 1b8zA  a.55.1.1 * 8e-08 34.5 %
:HMM:SCOP  1->58 1ihfA_ a.55.1.1 * 1.6e-10 40.4 %
:RPS:PFM   2->57 PF00216 * Bac_DNA_binding 2e-06 40.0 %
:HMM:PFM   2->59 PF00216 * Bac_DNA_binding 5.5e-17 38.6 57/90  
:BLT:SWISS 1->80 DBHL_RICCN 1e-43 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03295.1 GT:GENE himD GT:PRODUCT integration host factor beta-subunit GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(720651..720893) GB:FROM 720651 GB:TO 720893 GB:DIRECTION - GB:GENE himD GB:PRODUCT integration host factor beta-subunit GB:PROTEIN_ID AAL03295.1 GB:DB_XREF GI:15619852 GB:GENE:GENE himD LENGTH 80 SQ:AASEQ MITKNYLIDKIHDKLNCLSKEDVKDSVDLILDYLNESLKKQKRIEIRNFGNFSIRKRKFPESEKFYNTVYYRMPKNLFKE GT:EXON 1|1-80:0| SW:ID DBHL_RICCN SW:DE RecName: Full=DNA-binding protein HU-like; SW:GN OrderedLocusNames=RC0757; SW:KW Complete proteome; DNA condensation; DNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->80|DBHL_RICCN|1e-43|100.0|80/80| GO:SWS:NREP 2 GO:SWS GO:0030261|"GO:chromosome condensation"|DNA condensation| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| BL:PDB:NREP 1 BL:PDB:REP 18->60|1huuC|6e-08|41.9|43/71| RP:PDB:NREP 1 RP:PDB:REP 2->57|3c4iB|3e-09|27.3|55/97| RP:PFM:NREP 1 RP:PFM:REP 2->57|PF00216|2e-06|40.0|55/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 2->59|PF00216|5.5e-17|38.6|57/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 3->58|1b8zA|8e-08|34.5|55/67|a.55.1.1| HM:SCP:REP 1->58|1ihfA_|1.6e-10|40.4|57/96|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 75.0 SQ:SECSTR #ccHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEEEEE################### DISOP:02AL 79-80| PSIPRED cccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEccccccccEEEEccEEccHHHccc //