[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : holB
DDBJ      :holB         DNA polymerase III delta subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->130 2gnoA PDBj 5e-05 36.8 %
:RPS:PDB   73->125 3c58A PDBj 3e-07 11.3 %
:RPS:SCOP  1->152 1jr3A2  c.37.1.20 * 4e-11 16.8 %
:HMM:SCOP  1->196 1a5tA2 c.37.1.20 * 7e-22 24.2 %
:BLT:SWISS 56->130 HOLB_PSEAE 2e-08 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02751.1 GT:GENE holB GT:PRODUCT DNA polymerase III delta subunit GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 222576..223385 GB:FROM 222576 GB:TO 223385 GB:DIRECTION + GB:GENE holB GB:PRODUCT DNA polymerase III delta subunit GB:PROTEIN_ID AAL02751.1 GB:DB_XREF GI:15619265 GB:GENE:GENE holB LENGTH 269 SQ:AASEQ MILQPLIIERLEFNLKHNKLYNSWLIEAENIEQALKDLEEFIYIKLFKNSIPLDNNPDYHFIARETSATSNAKNISIEQIRKLQDFLSKTSAISGYKVAIIYSAELMNLNAANSCLKILEDAPKNSYIFLITSRAASIISTIRSRCFKINVRSSIHHTKNELYSEFIQSIADNKTLDFIHRFTTKDRELWLDFIDNLLLLMNRILKKSANVNIELLDLENKIFNKLSNRHPSYLLQKFTDIKKLIYNTIDYDLDLKTSYILVVNEFSSN GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 56->130|HOLB_PSEAE|2e-08|38.0|71/328| SEG 131->145|itsraasiistirsr| SEG 189->200|lwldfidnllll| BL:PDB:NREP 1 BL:PDB:REP 73->130|2gnoA|5e-05|36.8|57/293| RP:PDB:NREP 1 RP:PDB:REP 73->125|3c58A|3e-07|11.3|53/269| RP:SCP:NREP 1 RP:SCP:REP 1->152|1jr3A2|4e-11|16.8|149/240|c.37.1.20| HM:SCP:REP 1->196|1a5tA2|7e-22|24.2|190/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 21.6 SQ:SECSTR ########################################################################cTTcHHHHHHHHTTccEEEEEEETTEEEEEETTTEEEcTTTcEEEEEcTTcccTcEEE########################################################################################################################################### DISOP:02AL 268-269| PSIPRED cccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccccEEEcccHHcccccccccHHHHHHHHHHHHHcccccccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHccHHHHHHEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcc //