[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : hsp22
DDBJ      :hsp22        heat shock protein
Swiss-Prot:HSPC1_RICCN  RecName: Full=Small heat shock protein C1;

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   71->153 2wj7A PDBj 1e-05 31.6 %
:RPS:PDB   63->153 2bolB PDBj 3e-17 20.8 %
:RPS:SCOP  34->166 1gmeA  b.15.1.1 * 2e-16 21.1 %
:HMM:SCOP  24->168 1gmeA_ b.15.1.1 * 5.2e-21 24.1 %
:RPS:PFM   74->167 PF00011 * HSP20 1e-10 41.8 %
:HMM:PFM   72->166 PF00011 * HSP20 3e-21 29.5 95/102  
:HMM:PFM   34->74 PF03223 * V-ATPase_C 0.00056 30.8 39/371  
:BLT:SWISS 1->167 HSPC1_RICCN 4e-91 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02901.1 GT:GENE hsp22 GT:PRODUCT heat shock protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 363130..363633 GB:FROM 363130 GB:TO 363633 GB:DIRECTION + GB:GENE hsp22 GB:PRODUCT heat shock protein GB:PROTEIN_ID AAL02901.1 GB:DB_XREF GI:15619427 GB:GENE:GENE hsp22 LENGTH 167 SQ:AASEQ MLKSVRLYIPSIAVMILSSNIAIANKNYDAGNATPLRQVADLIDNQITNIDNLFKNRLSLYESNSIKSNFITKDKQYIIVMEVPGFDKSQIKVKVNGNKLFITGNIEEKNKADYSDNYMNKNFNYVISLYEDVDQANISSSLKNGILTIILPRIEIKEQEAREIVID GT:EXON 1|1-167:0| SW:ID HSPC1_RICCN SW:DE RecName: Full=Small heat shock protein C1; SW:GN Name=hspC1; OrderedLocusNames=RC0363; SW:KW Complete proteome; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->167|HSPC1_RICCN|4e-91|100.0|167/167| GO:SWS:NREP 1 GO:SWS GO:0006950|"GO:response to stress"|Stress response| TM:NTM 1 TM:REGION 4->25| BL:PDB:NREP 1 BL:PDB:REP 71->153|2wj7A|1e-05|31.6|79/85| RP:PDB:NREP 1 RP:PDB:REP 63->153|2bolB|3e-17|20.8|77/290| RP:PFM:NREP 1 RP:PFM:REP 74->167|PF00011|1e-10|41.8|91/101|HSP20| HM:PFM:NREP 2 HM:PFM:REP 72->166|PF00011|3e-21|29.5|95/102|HSP20| HM:PFM:REP 34->74|PF03223|0.00056|30.8|39/371|V-ATPase_C| RP:SCP:NREP 1 RP:SCP:REP 34->166|1gmeA|2e-16|21.1|133/150|b.15.1.1| HM:SCP:REP 24->168|1gmeA_|5.2e-21|24.1|145/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 27 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--------------------------------------------------------------1---------1--------------------------------------1-----------------------------------------------------------------------------------------1111113121111----------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 62.9 SQ:SECSTR ##############################################################EEccEEcTTccEEEEEEEEccTTccGGGEEEEEETTEEEEEEEcccccccTccccccccEEEEEEEcccEEcGGGcEEEEETTEEEEEEEEcccccccccccccc DISOP:02AL 1-5, 153-163| PSIPRED ccccHHHHHHHHEEEEEcccEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEcEEEcccEEEEEEEcccccHHEEEEEEEccEEEEEEEcccccccEEccEEEEEEEEEEEEccccccccEEEEEEEccEEEEEEEcccccccccEEEEcc //