[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : htpG
DDBJ      :htpG         heat shock protein htpG
Swiss-Prot:HTPG_RICCN   RecName: Full=Chaperone protein htpG;AltName: Full=Heat shock protein htpG;AltName: Full=High temperature protein G;

Homologs  Archaea  1/68 : Bacteria  597/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
d.122.1d.14.1d.271.1
:621 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->616 2iopA PDBj e-143 44.9 %
:RPS:PDB   3->44 2e4tA PDBj 5e-05 19.0 %
:RPS:PDB   29->208 2akpB PDBj 5e-20 31.6 %
:RPS:PDB   224->620 2cgeA PDBj 8e-92 33.5 %
:RPS:SCOP  1->211 1a4hA  d.122.1.1 * 9e-51 44.2 %
:RPS:SCOP  224->474 1hk7A  d.14.1.8 * 1e-70 37.0 %
:RPS:SCOP  503->616 1sf8A  d.271.1.1 * 1e-23 25.0 %
:HMM:SCOP  2->215 2iwxA1 d.122.1.1 * 4.5e-66 50.2 %
:HMM:SCOP  221->475 1usuA_ d.14.1.8 * 4.9e-87 45.7 %
:HMM:SCOP  502->618 1sf8A_ d.271.1.1 * 1e-29 39.1 %
:RPS:PFM   218->616 PF00183 * HSP90 2e-72 42.1 %
:HMM:PFM   215->619 PF00183 * HSP90 7.1e-99 35.5 400/531  
:HMM:PFM   31->180 PF02518 * HATPase_c 2.4e-12 21.8 101/111  
:BLT:SWISS 1->621 HTPG_RICCN 0.0 100.0 %
:PROS 24->33|PS00298|HSP90

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03840.1 GT:GENE htpG GT:PRODUCT heat shock protein htpG GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1203899..1205764 GB:FROM 1203899 GB:TO 1205764 GB:DIRECTION + GB:GENE htpG GB:PRODUCT heat shock protein htpG GB:PROTEIN_ID AAL03840.1 GB:DB_XREF GI:15620441 GB:GENE:GENE htpG LENGTH 621 SQ:AASEQ MIQEKKKFDAEVGKILNLMIHSLYSNKEIFMRELISNASDACDKLRYLSQSNSELVAGDSNFKITVKVDKDHRQIIIRDNGIGMNKDDLIENLGTIARSGTANFLKSLSGDSKKDNMLIGQFGVGFYSSFMVADKVTVTSRKAGEDKVHIWESDGLGEYTVSDSDKEFTRGTEIVLHIKKEEDTFLDHFRLKHIVKSYSDHIAVPIYFFDEAGNNEIQLNSASALWTRPKSEITEEQYKEFYKSLSYAIDDPWITMHNKNEGAIEFTNLLFIPSSKTFDLFHPDRKRRVKLYIKRVFISDENIDLIPSYLRFLRGVVDSEDLPLNISRESLQHNSVLEKIKNAITKRVLGELRKKKEESPEEYNKFWANFGGALKEGLCEATTNHEKLLEVCIFRSALHNKMISLDEYIANFKEGQSTIYYLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVEQTTSQSEEKNTDSTKSNDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDIRMERFLIEQKQIANASAKNLELNPKNKIIEKIFNDLKANNKNNEELVNLIFDQACILEGEPVADTGAFSKRLNDIVQKAIL GT:EXON 1|1-621:0| SW:ID HTPG_RICCN SW:DE RecName: Full=Chaperone protein htpG;AltName: Full=Heat shock protein htpG;AltName: Full=High temperature protein G; SW:GN Name=htpG; OrderedLocusNames=RC1302; SW:KW ATP-binding; Chaperone; Complete proteome; Cytoplasm;Nucleotide-binding; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->621|HTPG_RICCN|0.0|100.0|621/621| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 24->33|PS00298|HSP90|PDOC00270| BL:PDB:NREP 1 BL:PDB:REP 3->616|2iopA|e-143|44.9|602/618| RP:PDB:NREP 3 RP:PDB:REP 3->44|2e4tA|5e-05|19.0|42/509| RP:PDB:REP 29->208|2akpB|5e-20|31.6|177/181| RP:PDB:REP 224->620|2cgeA|8e-92|33.5|391/405| RP:PFM:NREP 1 RP:PFM:REP 218->616|PF00183|2e-72|42.1|394/417|HSP90| HM:PFM:NREP 2 HM:PFM:REP 215->619|PF00183|7.1e-99|35.5|400/531|HSP90| HM:PFM:REP 31->180|PF02518|2.4e-12|21.8|101/111|HATPase_c| RP:SCP:NREP 3 RP:SCP:REP 1->211|1a4hA|9e-51|44.2|208/214|d.122.1.1| RP:SCP:REP 224->474|1hk7A|1e-70|37.0|243/248|d.14.1.8| RP:SCP:REP 503->616|1sf8A|1e-23|25.0|112/115|d.271.1.1| HM:SCP:REP 2->215|2iwxA1|4.5e-66|50.2|211/0|d.122.1.1|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| HM:SCP:REP 221->475|1usuA_|4.9e-87|45.7|254/256|d.14.1.8|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 502->618|1sf8A_|1e-29|39.1|115/115|d.271.1.1|1/1|HSP90 C-terminal domain| OP:NHOMO 1527 OP:NHOMOORG 794 OP:PATTERN ----------------------------------------------------1--------------- ----2---111----1111-11111-1111111---1111-111-------------1--11--21-1211--------111------22111111111112111111-1--------------11111111111111111---3-1111111111111111111111111111111111111----------1---------------1111-1-------11111111112-------------------------------------------------------------------------------------------111111111111111111-1211111--121-11111--1-------1-------------1111111-11111------------11111111-1--1--1111-1-111---------1-1--111111111111111111111111111111111111111111111---1--111111111111111111111111111111111--11111111111111111121111-------1111111-111111111111-111111111----21--1111111111111111111111-11111111111111111111111111111111111--111111111112111111111111111-1111221111111111112111111111111111112111111111111-111111111111111--1111111111111211111111-11111111111-11111111222211111111111111111-11111111111111111112222222222111111111111221111111111----------------------------1--------11 45223331DJ332221111111111111111111111111111111111111111111111111111111111113222211111111-3221222222221-4451376967545A31A74545O6G7M*5-E8C556665443255264346585456CD333a4356944452334*44443A9ED1964443336 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 620 STR:RPRED 99.8 SQ:SECSTR cccccccccccHHHHHHHHHHcccccTTHHHHHHHHHHHHHHHHHHHHTcccTTTTTTcccccEEEEEEGGGTEEEEEEccccccHHHHHGGGccccccTTHHHHccccccccccGTccccTTcTTGGGGGTEEEEEEEEEcTTccEEEEEEcccccEEEEEccccccccEEEEEEEEcTTGGGGGcHHHHHHHHHHHcTTccccEEEccccccccccccccccGGGccGGGccTTHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEcccccccccccccccccEEEETTEEEEccccccccGGGTTcEEEEEEccccccccTTcTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHcTTTHHHHHTTcEEccccccccEEHHHHHHTccTTcccEEEEEcccHHHHHTcTTHHHHHHHTccEEEEccHHHHHHHHHHccccccEEEccccccccccHcccccTHHHHHHHHHHHHHHHHHHHHHHHHTTcccEEEEccccccccEEEEEccccccHHHHHHHHHHHTTcccccEEEEEcTTcHHHHHHHHHHTTTGGGcHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHH# DISOP:02AL 1-3, 103-117, 478-498, 542-560| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHccccccEEEEEEEEccccEEEEEEccccccHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEccccEEEEEcccccccccEEEEEEEccccHHHccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEccccccEEEEEEEEEcccccHHHccccccccEEEEEEEEEEEcccHHHHHHHHHHEEEEEEcccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccEEEHHHHHHHccccccEEEEEEcccHHHHHcccHHHHHHHcccEEEEEccccHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEccccccHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcc //