[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : ilvE
DDBJ      :ilvE         branched-chain amino acid aminotransferase
Swiss-Prot:ILVE_RICCN   RecName: Full=Probable branched-chain-amino-acid aminotransferase;         Short=BCAT;         EC=2.6.1.42;

Homologs  Archaea  37/68 : Bacteria  683/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:290 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->263 1i1kA PDBj 6e-50 40.2 %
:RPS:PDB   13->289 2ej0D PDBj 2e-69 38.0 %
:RPS:SCOP  13->289 1a3gA  e.17.1.1 * 2e-67 37.8 %
:HMM:SCOP  11->289 1daaA_ e.17.1.1 * 6.7e-75 37.5 %
:RPS:PFM   52->263 PF01063 * Aminotran_4 8e-31 34.8 %
:HMM:PFM   52->284 PF01063 * Aminotran_4 2.7e-44 28.3 223/232  
:BLT:SWISS 1->290 ILVE_RICCN e-169 100.0 %
:PROS 189->217|PS00770|AA_TRANSFER_CLASS_4

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03132.1 GT:GENE ilvE GT:PRODUCT branched-chain amino acid aminotransferase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 581191..582063 GB:FROM 581191 GB:TO 582063 GB:DIRECTION + GB:GENE ilvE GB:PRODUCT branched-chain amino acid aminotransferase GB:PROTEIN_ID AAL03132.1 GB:DB_XREF GI:15619677 GB:GENE:GENE ilvE LENGTH 290 SQ:AASEQ MTMVKLEQIFWHVWINGDLVPYQFARIHVLTHSLHYSGSVFEGERAYNGKVFKLKEHTARLIKSAEALGLKVPYNVDEIIKAHECVIKQNNIKDAYIRPLIWCGDESLNITNQYLSTNLLIAGIPSMPRSFEKGINLHVSRWRKAMPDSTPVQSKSAAQYNMAITSKKEAKALGYEDALLLDYEGYIAECTTTNIFFVKDKILYTPIADRFLNGITRQTIIEIAKDLGLEVKEERLKLEQIEDFTGCFVTGTAIEVQNIDSIDLGNKKIIFDDHKIADRLKEEYRRVVRE GT:EXON 1|1-290:0| SW:ID ILVE_RICCN SW:DE RecName: Full=Probable branched-chain-amino-acid aminotransferase; Short=BCAT; EC=2.6.1.42; SW:GN Name=ilvE; OrderedLocusNames=RC0594; SW:KW Amino-acid biosynthesis; Aminotransferase;Branched-chain amino acid biosynthesis; Complete proteome;Pyridoxal phosphate; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->290|ILVE_RICCN|e-169|100.0|290/290| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0008483|"GO:transaminase activity"|Aminotransferase| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 189->217|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| BL:PDB:NREP 1 BL:PDB:REP 12->263|1i1kA|6e-50|40.2|249/298| RP:PDB:NREP 1 RP:PDB:REP 13->289|2ej0D|2e-69|38.0|274/301| RP:PFM:NREP 1 RP:PFM:REP 52->263|PF01063|8e-31|34.8|210/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 52->284|PF01063|2.7e-44|28.3|223/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 13->289|1a3gA|2e-67|37.8|267/295|e.17.1.1| HM:SCP:REP 11->289|1daaA_|6.7e-75|37.5|269/277|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 1250 OP:NHOMOORG 804 OP:PATTERN ------------------111--1211223221111111111211111111111-----------122 11211-1------1------------------1---1-21-2111-111---1111-111-1-11--22---------121112222111111111-111--11221112---------------111111111112222211122311222111221111111122---1111211111211---1121-22355555555355555533334355533221221111113212222222222222211122-1-1---2-1------------1111111-1-1---------------1--1----11-----------122122111121122221224211111-22112222111111222112-11121-11--11112332111-2222-22222222114-22222211243-52233332221212241454434432422222222111--113----------111111111111111----11121212222133132411111111222212212222211224111111111211111211111111111211122223122111231111111111111322211-2122221111111111111111111111111-121-1-11111111211112122122---2111------11121111111111111-1111111111111111111111331311111111111111111111111111-11111111111111-1111112212212-------------111111111111111111111111111111111111-111112-2211111111111--------------221-111111----------1-------------------------1211-11111111 ------1--------21-1-221112111111111111-1-11111--322231221--111111----1--1-1------11122------1111----1--212--4-----------------------------------------------------1--1-----111-1312P2222-558619513----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 290 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEETTTEEETTEEEcGGGccccTTcHHHHHccEEEccEEEEEETEEcHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHTTcccEEEEEEEEcccccccccGGGcccEEEEEEEEccccccTTcEEEEEcccccccTTTccTTcccGGGHHHHHHHHHHHHHTTccEEEEEcTTccEEEEcccEEEEEETTEEEEEccTTccccHHHHHHHHHHHHTTcEEEEEcccHHHHHTccEEEEEETTTEEEEEEEETcTTTEEcTTccHHHHHHHHHHHHHHTT PSIPRED ccccccccccccEEEccEEEEHHHcccccccHHHHHccEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccEEEEEEEEEccccccccccccccEEEEEEEccccccccccEEEEEEEEEEcccccccccHHHccccHHHHHHHHHHHHccccEEEEEcccccEEEcccEEEEEEEccEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHcccEEEEEcccEEEEEEEEEEEccEEEEccccHHHHHHHHHHHHHHcc //