[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : infA
DDBJ      :infA         translation initiation factor IF-1
Swiss-Prot:IF1_RICRS    RecName: Full=Translation initiation factor IF-1;

Homologs  Archaea  0/68 : Bacteria  879/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:71 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->70 1ah9A PDBj 1e-23 66.7 %
:RPS:PDB   2->71 1ah9A PDBj 3e-17 65.7 %
:RPS:SCOP  1->71 1jt8A  b.40.4.5 * 7e-19 21.4 %
:HMM:SCOP  1->71 1hr0W_ b.40.4.5 * 3.8e-29 59.2 %
:RPS:PFM   5->70 PF01176 * eIF-1a 4e-18 62.1 %
:HMM:PFM   6->70 PF01176 * eIF-1a 4.2e-28 43.8 64/65  
:BLT:SWISS 1->71 IF1_RICRS 2e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03803.1 GT:GENE infA GT:PRODUCT translation initiation factor IF-1 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1167340..1167555 GB:FROM 1167340 GB:TO 1167555 GB:DIRECTION + GB:GENE infA GB:PRODUCT translation initiation factor IF-1 GB:PROTEIN_ID AAL03803.1 GB:DB_XREF GI:15620401 GB:GENE:GENE infA LENGTH 71 SQ:AASEQ MSKDDLIQFTGTVLELLPNATFRVKLENDHVIIAHTSGRMRKNRIRILLGDKVMVEMTPYDLTKGRVIHRH GT:EXON 1|1-71:0| SW:ID IF1_RICRS SW:DE RecName: Full=Translation initiation factor IF-1; SW:GN Name=infA; OrderedLocusNames=A1G_06945; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->71|IF1_RICRS|2e-37|100.0|71/71| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 2->70|1ah9A|1e-23|66.7|69/71| RP:PDB:NREP 1 RP:PDB:REP 2->71|1ah9A|3e-17|65.7|70/71| RP:PFM:NREP 1 RP:PFM:REP 5->70|PF01176|4e-18|62.1|66/66|eIF-1a| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF01176|4.2e-28|43.8|64/65|eIF-1a| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01176|IPR006196| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF01176|IPR006196| GO:PFM GO:0006413|"GO:translational initiation"|PF01176|IPR006196| RP:SCP:NREP 1 RP:SCP:REP 1->71|1jt8A|7e-19|21.4|70/102|b.40.4.5| HM:SCP:REP 1->71|1hr0W_|3.8e-29|59.2|71/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 970 OP:NHOMOORG 890 OP:PATTERN -------------------------------------------------------------------- 1111211111111111111-11111111111111111111111111111111111111111111111211111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--------11111111------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111-1112111111111111111111111111111211111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111222122222233232321112222222221222333312222212332121111112222221-1111111122211111112112222-11111111122221111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111112111111111111111111-1111111---1-11-11111111111-11121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1-1-2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 100.0 SQ:SECSTR ccccccEEccEEEEEEccccEEEEEETTccEEEEEEcccGGGTTccccTTcEEccEEccccTTEEEEcccc DISOP:02AL 1-2| PSIPRED cccccEEEEEEEEEEcccccEEEEEEccccEEEEEEccEEEEEEEEEEEccEEEEEEccccccccEEEEEc //