[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : kpsF
DDBJ      :kpsF         kpsF protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  548/915 : Eukaryota  75/199 : Viruses  1/175   --->[See Alignment]
c.80.1d.37.1
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->190 3fxaC PDBj 6e-24 32.0 %
:BLT:PDB   203->287 3fnaB PDBj 3e-08 41.8 %
:RPS:PDB   28->288 2df8B PDBj 1e-28 15.8 %
:RPS:SCOP  29->285 1j5xA  c.80.1.1 * 2e-25 18.5 %
:HMM:SCOP  10->255 1moqA_ c.80.1.1 * 1.1e-58 33.8 %
:HMM:SCOP  258->315 1pbjA2 d.37.1.1 * 1.9e-10 37.9 %
:RPS:PFM   46->161 PF01380 * SIS 3e-14 35.3 %
:HMM:PFM   43->168 PF01380 * SIS 1.9e-26 37.9 124/131  
:HMM:PFM   200->255 PF00571 * CBS 2e-11 29.6 54/57  
:HMM:PFM   264->315 PF00571 * CBS 1.1e-13 28.8 52/57  
:BLT:SWISS 1->319 Y505_RICPR e-141 86.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03199.1 GT:GENE kpsF GT:PRODUCT kpsF protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(641425..642384) GB:FROM 641425 GB:TO 642384 GB:DIRECTION - GB:GENE kpsF GB:PRODUCT kpsF protein GB:PROTEIN_ID AAL03199.1 GB:DB_XREF GI:15619749 GB:GENE:GENE kpsF LENGTH 319 SQ:AASEQ MTNTNNYRIIAKRVISSEASALEKLSENIPEDFNRIIEFLLSFKGRIILTGIGKSGYIARKIAASFSSTGMPAFYLHPAEASHGDLGMVTRNDLVIMLSNSGETKELFNIIEYCKNSSIKIAAMTMNKNSTLAKRSDFLLIVPEYPEASVIEVPTISSLIMLSLGDALMTVIHEKRGFTKDDFKIYHPGGTIGANLTKIKHLMRSGDEIPLVYEDTSFAKTIIIMSKKRLGCTLVTDKNQNLVGIITDGDLRRHINDQIHLKTASSIMTKNPIHISSEIFAKEALNLMKAKNITNIPIVDDNIIIGIIHIHDLLRIGVS GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 1->319|Y505_RICPR|e-141|86.8|319/319| SEG 16->27|sseasaleklse| SEG 292->312|nitnipivddniiigiihihd| BL:PDB:NREP 2 BL:PDB:REP 35->190|3fxaC|6e-24|32.0|153/187| BL:PDB:REP 203->287|3fnaB|3e-08|41.8|79/114| RP:PDB:NREP 1 RP:PDB:REP 28->288|2df8B|1e-28|15.8|253/324| RP:PFM:NREP 1 RP:PFM:REP 46->161|PF01380|3e-14|35.3|116/131|SIS| HM:PFM:NREP 3 HM:PFM:REP 43->168|PF01380|1.9e-26|37.9|124/131|SIS| HM:PFM:REP 200->255|PF00571|2e-11|29.6|54/57|CBS| HM:PFM:REP 264->315|PF00571|1.1e-13|28.8|52/57|CBS| GO:PFM:NREP 2 GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| RP:SCP:NREP 1 RP:SCP:REP 29->285|1j5xA|2e-25|18.5|254/319|c.80.1.1| HM:SCP:REP 10->255|1moqA_|1.1e-58|33.8|240/0|c.80.1.1|1/1|SIS domain| HM:SCP:REP 258->315|1pbjA2|1.9e-10|37.9|58/61|d.37.1.1|2/2|CBS-domain| OP:NHOMO 745 OP:NHOMOORG 624 OP:PATTERN -------------------------------------------------------------------- 111------------------------------111---------1--------------------------------1----111111121-111---111111111-111111111111111111111111111----------1--1-----11111-11-------1-1-----1-----------1-------------------1--------------11111---------------------------------1-----1----11-11--------------------------------------------1---------------2-------1--------------1--------11111111111111--1111111111111111111111-1111111111111111111111331111111111111111111111111111111------------1111111111111----1-12-111111211112111111121222222211211211111111111111111111111111111111---11111111111--1211111111111111111-11111111111111111111111111111112111111111111111111111111111--11111------21111212224244422-2222434222243322332222111112222222222222222331222221122222222222211111111111111111111211111111111111111111111111111111121221111111111111112111111111211111111111111111111111111------------------------------------------1---111 ---------------111111111111111111-1-1-1-11111111111111-1111111111111-1--111-----111111------1-------1-1111----------------------------------------------------------------1--1---------1121-3211--1---- ---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 291 STR:RPRED 91.2 SQ:SECSTR HHHHHHTTcGcccHHHTTHHHHHHHHHHHHHHHHHHTTTcccccTEEEEEEcTHHHHHHHHHHHHHHHTTcEEEEEEHHHHHHHGGcccccccEEEEEccccccHHHHHHHHHHHTccccEEEEEcccccHHHHTccEEEEccccccccccccccHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHTTHHHHHHHHHccccEEEEEEcTTHHHHHHHHHHHccEEEEEEGGGGGTTGGGGccTTEEEEEEEccccHHHHHHHHHHHHTTcEEEEEEcccccccTTc############################ DISOP:02AL 1-4| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEccccccHHHHccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHccccEEEEEEcccEEEEEEEHHHHHHHHHcccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHcc //