[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : lipB
DDBJ      :lipB         probable lipoate-protein ligase B
Swiss-Prot:LIPB_RICCN   RecName: Full=Octanoyltransferase;         EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B;

Homologs  Archaea  4/68 : Bacteria  611/915 : Eukaryota  159/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:209 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->195 1w66A PDBj 4e-29 40.7 %
:RPS:PDB   1->208 2c8mA PDBj 3e-31 17.4 %
:RPS:SCOP  1->195 1w66A1  d.104.1.3 * 1e-45 38.0 %
:HMM:SCOP  3->210 1w66A1 d.104.1.3 * 8.4e-59 41.8 %
:RPS:PFM   32->79 PF06101 * DUF946 2e-04 36.4 %
:RPS:PFM   55->161 PF03099 * BPL_LplA_LipB 2e-05 32.0 %
:HMM:PFM   50->164 PF03099 * BPL_LplA_LipB 4.8e-21 30.2 106/125  
:BLT:SWISS 1->209 LIPB_RICCN e-121 100.0 %
:PROS 69->84|PS01313|LIPB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03895.1 GT:GENE lipB GT:PRODUCT probable lipoate-protein ligase B GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1254837..1255466) GB:FROM 1254837 GB:TO 1255466 GB:DIRECTION - GB:GENE lipB GB:PRODUCT probable lipoate-protein ligase B GB:PROTEIN_ID AAL03895.1 GB:DB_XREF GI:15620501 GB:GENE:GENE lipB LENGTH 209 SQ:AASEQ MIRFITIPDFADYQVTLKLMEDYVNKVISDHKPEIIYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQRVIYPILNLASPNRHKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLVTSLNQLGIHVEMSEFDKIIQTEFNKIFK GT:EXON 1|1-209:0| SW:ID LIPB_RICCN SW:DE RecName: Full=Octanoyltransferase; EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B; SW:GN Name=lipB; OrderedLocusNames=RC1357; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->209|LIPB_RICCN|e-121|100.0|209/209| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 69->84|PS01313|LIPB|PDOC01017| BL:PDB:NREP 1 BL:PDB:REP 12->195|1w66A|4e-29|40.7|177/218| RP:PDB:NREP 1 RP:PDB:REP 1->208|2c8mA|3e-31|17.4|190/241| RP:PFM:NREP 2 RP:PFM:REP 32->79|PF06101|2e-04|36.4|44/161|DUF946| RP:PFM:REP 55->161|PF03099|2e-05|32.0|100/118|BPL_LplA_LipB| HM:PFM:NREP 1 HM:PFM:REP 50->164|PF03099|4.8e-21|30.2|106/125|BPL_LplA_LipB| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF03099|IPR004143| GO:PFM GO:0006464|"GO:protein modification process"|PF03099|IPR004143| RP:SCP:NREP 1 RP:SCP:REP 1->195|1w66A1|1e-45|38.0|187/216|d.104.1.3| HM:SCP:REP 3->210|1w66A1|8.4e-59|41.8|201/0|d.104.1.3|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 837 OP:NHOMOORG 774 OP:PATTERN ------------------111----------------------------------------2------ 1111111111111111111-111111111111111111111111111111111111111111111111111-----------1--1111111-111-1111111111111------------------------1-111-1---1111111111111111111111111111111111111111111111-1----------------------------------------1------------------------------------------------------------------------------------------11---------------11-----------------1------1111---1--111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1--11-1111-111-11111111111-1----------------------11-111111111111111111111111111111111-1111111111111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111-----------------------------------------------11 --------311-111111-111-111111111111111111--1-11111111-111-1--111111111111111111111111111-12111111-1112111--13-2-1121-111-1111-11111--111---111121-1----1111-1-11121111111171-212222M2221222521332221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 99.5 SQ:SECSTR EEEEc#cccTTcHHHHHHHHHHHHHHccTTccccEEEEEccccEEEEcTTccHHHHccHHTcEEEEcccccccEEEcTTEEEEEEEEEccccGccccHHHHHHHHHHHHHHHHHHTTcccEEEcccccTTccccEEccccTTcEEETEETTEEEEEEEEEccccHHHHHHHTccccccTTcccGGGGTccccHHHHHHHHHHHHHHHHT PSIPRED cEEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEcccccHHHHHccccccEEEEccccEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccEEcccccEEEEccccccccEEEEEEEcccccEEEEEEEEEEccccHHHHcccccccccccEEEHHHHcccccHHHHHHHHHHHHHHHHc //