[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : lpxA
DDBJ      :lpxA         acyl-[acyl carrier protein]--UDP-N- acetylglucosamine O-acyltransferase
Swiss-Prot:LPXA_RICCN   RecName: Full=Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase;         Short=UDP-N-acetylglucosamine acyltransferase;         EC=2.3.1.129;

Homologs  Archaea  0/68 : Bacteria  558/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->238 2jf2A PDBj 1e-57 44.0 %
:RPS:PDB   3->261 2aq9A PDBj 1e-20 41.5 %
:RPS:SCOP  4->262 1j2zA  b.81.1.1 * 8e-35 40.1 %
:HMM:SCOP  6->261 2jf2A1 b.81.1.1 * 3.6e-61 36.5 %
:HMM:PFM   15->32 PF00132 * Hexapep 6.6e-06 50.0 18/18  
:HMM:PFM   52->67 PF00132 * Hexapep 0.0001 50.0 16/18  
:HMM:PFM   124->140 PF00132 * Hexapep 0.00096 35.3 17/18  
:BLT:SWISS 1->264 LPXA_RICCN e-151 100.0 %
:PROS 151->179|PS00101|HEXAPEP_TRANSFERASES
:REPEAT 2|22->72|119->169

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02546.1 GT:GENE lpxA GT:PRODUCT acyl-[acyl carrier protein]--UDP-N- acetylglucosamine O-acyltransferase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(6611..7405) GB:FROM 6611 GB:TO 7405 GB:DIRECTION - GB:GENE lpxA GB:PRODUCT acyl-[acyl carrier protein]--UDP-N- acetylglucosamine O-acyltransferase GB:PROTEIN_ID AAL02546.1 GB:DB_XREF GI:15619040 GB:GENE:GENE lpxA LENGTH 264 SQ:AASEQ MSNSNIHTTAVIAEGAKLGKNVKIGPYCIIGPEVVLHDNVELKSHVVIEGITEIGENTVIYPFASIGQPPQILKYANERSSTIIGSNNTIREYVTVQAGSQRGGMMTRVGNNNLFMVGVHIGHDCKIGNNVVFANYVSLAGHIGVGDYTIIGGLSAVHQYARIGEYSMIGGLSPVGADVIPFGLVSSKRAVLEGLNLIGMNRKGFDKVKSLSALKAIEEIFSGEGNFAERIKQVAEKYNNNSIVIQIIDFLNQDSNRAFCRFEK GT:EXON 1|1-264:0| SW:ID LPXA_RICCN SW:DE RecName: Full=Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; Short=UDP-N-acetylglucosamine acyltransferase; EC=2.3.1.129; SW:GN Name=lpxA; OrderedLocusNames=RC0008; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Lipid A biosynthesis;Lipid synthesis; Repeat; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->264|LPXA_RICCN|e-151|100.0|264/264| GO:SWS:NREP 5 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 151->179|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| NREPEAT 1 REPEAT 2|22->72|119->169| BL:PDB:NREP 1 BL:PDB:REP 6->238|2jf2A|1e-57|44.0|232/264| RP:PDB:NREP 1 RP:PDB:REP 3->261|2aq9A|1e-20|41.5|258/262| HM:PFM:NREP 3 HM:PFM:REP 15->32|PF00132|6.6e-06|50.0|18/18|Hexapep| HM:PFM:REP 52->67|PF00132|0.0001|50.0|16/18|Hexapep| HM:PFM:REP 124->140|PF00132|0.00096|35.3|17/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 4->262|1j2zA|8e-35|40.1|257/259|b.81.1.1| HM:SCP:REP 6->261|2jf2A1|3.6e-61|36.5|255/0|b.81.1.1|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 980 OP:NHOMOORG 571 OP:PATTERN -------------------------------------------------------------------- 134-----------------------------------11-----1-------------------------------------221223323-3112--123232221-111111111111111121122211212----------1222222223311111112322122112112211121-----211--------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2------1-21122111111111--1212312321311111111111-1111112121111111112111111211211111111222222222221222111------------1111112111111----2-----11111222222122222222222222222111122131111221111111111122112222222--111222222211--1111112112323211111-11222212222212222222222222211221221212222222222222222222222--22112------22222222222222222-2222222322222222222222222222222222222222222323222222232222222222211221111155452111221222222221222222222222321122222221222212222444444434222222222222122111111111122222222333333----------------------------------------------231 ------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------11---------1112-11--1212- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 98.9 SQ:SECSTR ETTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEcTTcEEccccEEccEEEEccccEEcTTcEEEEccccTTccccccEEEEccccEEcTTcEEEcccTTTTcEEEEccccEEcTTcEEcTTcEEccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEccccEEcccccTTEEEETcTTEEEEEcHHHHHHTTccHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHTTcGGGHHHHHHHHHcccccccc### DISOP:02AL 263-264| PSIPRED ccccEEccccEEccccEEcccEEEccccEEccccEEccccEEcccEEEEEEEEEccccEEEEEEEEccccEEcccccccccEEEccccEEEcccEEccccccccccEEEEEEEEEccccEEcccEEccccEEEccccEEccEEEEccccEEccccEEEccEEEccccEEEccEEEccccccccEEEccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHccccccEEEccc //