[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : mpg
DDBJ      :mpg          DNA-3-methyladenine glycosidase
Swiss-Prot:3MGH_RICCN   RecName: Full=Putative 3-methyladenine DNA glycosylase;         EC=3.2.2.-;

Homologs  Archaea  5/68 : Bacteria  311/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
b.46.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->132 1f4rA PDBj 5e-15 44.7 %
:RPS:PDB   5->171 1bnkA PDBj 7e-37 33.1 %
:RPS:SCOP  5->171 1bnkA  b.46.1.2 * 3e-37 33.1 %
:HMM:SCOP  3->185 1ewnA_ b.46.1.2 * 1.4e-53 42.5 %
:RPS:PFM   8->169 PF02245 * Pur_DNA_glyco 2e-34 51.6 %
:HMM:PFM   8->171 PF02245 * Pur_DNA_glyco 2.9e-60 47.0 164/184  
:BLT:SWISS 1->183 3MGH_RICCN e-107 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03018.1 GT:GENE mpg GT:PRODUCT DNA-3-methyladenine glycosidase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(475819..476370) GB:FROM 475819 GB:TO 476370 GB:DIRECTION - GB:GENE mpg GB:PRODUCT DNA-3-methyladenine glycosidase GB:PROTEIN_ID AAL03018.1 GB:DB_XREF GI:15619554 GB:GENE:GENE mpg LENGTH 183 SQ:AASEQ MNKLIPVPREFFARDTNVVSTELIGKALYFQGKTAIITETESYIGQNDPACHAARGRTKRTDIMFGPAGFSYVYLIYGMYYCLNFVTEAKGFPAATLIRGVHVILPENLYLNGPGKLCKYLGINISHNKCDLINNNEFFVGDIGLKLPYSTTARIGITKGTDKLWRYVVTDITNLISQYNVQP GT:EXON 1|1-183:0| SW:ID 3MGH_RICCN SW:DE RecName: Full=Putative 3-methyladenine DNA glycosylase; EC=3.2.2.-; SW:GN OrderedLocusNames=RC0480; SW:KW Complete proteome; DNA damage; DNA repair; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->183|3MGH_RICCN|e-107|100.0|183/183| GO:SWS:NREP 3 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 37->132|1f4rA|5e-15|44.7|94/199| RP:PDB:NREP 1 RP:PDB:REP 5->171|1bnkA|7e-37|33.1|160/200| RP:PFM:NREP 1 RP:PFM:REP 8->169|PF02245|2e-34|51.6|159/185|Pur_DNA_glyco| HM:PFM:NREP 1 HM:PFM:REP 8->171|PF02245|2.9e-60|47.0|164/184|Pur_DNA_glyco| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF02245|IPR003180| GO:PFM GO:0003905|"GO:alkylbase DNA N-glycosylase activity"|PF02245|IPR003180| GO:PFM GO:0006284|"GO:base-excision repair"|PF02245|IPR003180| RP:SCP:NREP 1 RP:SCP:REP 5->171|1bnkA|3e-37|33.1|160/200|b.46.1.2| HM:SCP:REP 3->185|1ewnA_|1.4e-53|42.5|181/214|b.46.1.2|1/1|FMT C-terminal domain-like| OP:NHOMO 393 OP:NHOMOORG 364 OP:PATTERN ----------------1-----------------------------1-----------------1-11 111111-111111111111-1-11111111111---1111111111--1111111111--1111111111--------1---1-------------1--1-----11-11-------1111111-11111111-11--------11---1---1111111111--11---11111-113111-----------11111111111111111-11-1111----111111111--1------------------1--1-11-1---1111--1----------------11------------------------1-----------1111111111111-1111111-1--------11111--11-------11-11--1------111111111111------------113111111---111111111111--------1111---------------1------11111--1111111111111111111------------1111------1-11------1----------------------1----------------11---1--------------111------111111--------------------------------------------------------------1----------------------------------------------------------------------------------------------2------1111--------------------111111--1--1------------------11-1-111---------------1-1111111---------------11111111--------------------------------------11- 1-------1-------------------------------------------------------------------------------------------------2---211111-1-1--1112111663-213-1--3-111-1--11--2111--111-1-1-------22-----------111-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 88.5 SQ:SECSTR ####TcccHHHHcccHHHHHHHHTTcEEEEEcTTEEEEEEEEEccTTcTTcTTGGGccTTGGGGGccTTcEEEEEETTTEEEEEEEcccccTTcEEEEEEEEEEccTHHHHccHHHHHHHTTccGGGTTccTTccccEE#####EEccEEEEcccGGGGGGccccEEEETT############ DISOP:02AL 1-2| PSIPRED ccccccccHHHHcccHHHHHHHHcccEEEEEcccEEEEEEEccccccccccccccccccccHHHHcccccEEHHHHHHHHEEEEEEEcccccccEEEEEEEcccccHHHHHccHHHHHHHHcccHHHcccccccccccEEEcccccccEEEEccccccHHHccccEEEEccccEEEEEEcccc //