[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : mrcA
DDBJ      :mrcA         penicillin-binding protein 1a
Swiss-Prot:PBPA_RICCN   RecName: Full=Penicillin-binding protein 1A;         Short=PBP-1a;         Short=PBP1a;Includes:  RecName: Full=Penicillin-insensitive transglycosylase;           EC=2.4.2.-;  AltName: Full=Peptidoglycan TGase;Includes:  RecName: Full=Penicillin-sensitive transpeptidase;           EC=3.4.-.-;  AltName: Full=DD-transpeptidase;

Homologs  Archaea  0/68 : Bacteria  829/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.2.1e.3.1
:790 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->249 2oqoA PDBj 5e-40 47.2 %
:BLT:PDB   402->747 3fwmA PDBj 2e-20 26.7 %
:RPS:PDB   65->248 3d3hA PDBj 2e-62 52.3 %
:RPS:PDB   226->313 3by7D PDBj 4e-16 8.5 %
:RPS:PDB   377->755 2bg1A PDBj 2e-57 19.8 %
:RPS:SCOP  45->261 2oluA1  d.2.1.10 * 3e-63 33.5 %
:RPS:SCOP  265->337 2c5wB1  e.3.1.1 * 1e-07 16.0 %
:RPS:SCOP  388->748 2oluA2  e.3.1.1 * 4e-55 18.4 %
:HMM:SCOP  215->745 2bg1A1 e.3.1.1 * 3.3e-117 43.3 %
:RPS:PFM   58->233 PF00912 * Transgly 1e-51 52.6 %
:RPS:PFM   420->688 PF00905 * Transpeptidase 2e-35 40.9 %
:HMM:PFM   56->233 PF00912 * Transgly 3.6e-63 48.0 175/178  
:HMM:PFM   419->711 PF00905 * Transpeptidase 3.6e-38 34.7 259/304  
:BLT:SWISS 1->790 PBPA_RICCN 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03783.1 GT:GENE mrcA GT:PRODUCT penicillin-binding protein 1a GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1150700..1153072) GB:FROM 1150700 GB:TO 1153072 GB:DIRECTION - GB:GENE mrcA GB:PRODUCT penicillin-binding protein 1a GB:PROTEIN_ID AAL03783.1 GB:DB_XREF GI:15620379 GB:GENE:GENE mrcA LENGTH 790 SQ:AASEQ MYKSLLFCLKIFVFLILVGCGITAYIIYHYSRDLPDYSQLARYYPPSVTRIYSRDGKLMEEYAFERRVFVPINSVPSSLIESFIAAEDKNFYNHPGVDLFGIVRAAFLNISNYLHHRRMEGASTITQQVVKNFLLTNEVSLERKIKEAILSYMISRVFTKDQILELYLNQTFFGRGAYGVAVAAQNYFNKSVEELTIAESAFIAALPKAPSELNPERNYARVKARRDYVITRMFEDGYITRDAAKEAMDSPIVLRKRAKEETVTADYYAAQVREEVIRMLNSKEVFYTGGLTIITSLDAKMQQLAENSLRKGLREFDRRCGFRKPIANISLDNWQGELKKLPTPPSLLEYKLAVVLDVADNHVEIGLIDGSKSKMPIAEMKWARSNFKSVKTLLKKGDVIVVEAIKEGYALRQIPEVNGAIMVMNPNTGQVLASVGGYDFSTSKFDRVTQALRQPGSLSKTFVYLAALENGVKPNQIFNDGPIEISQGPGMPSWRPKNYEGKFLGEITMRTGLEKSRNLITVRVATAVGLTKIVDIIKRFGINNEPKKVYSMVLGSIETTLSRMTNAYAIIANGGKKVEPHFVELIKDRNGKIIYRRDDRECLACNVSDSNLDTAILEIPKEYIYRVTDEASDYQITSFLTGAIDRGTGYAAKKLGKIIGGKTGTSNDSKDTWFVGFTPKIVVGSYVGYDTPKELGKRATGSNVVLPIFIDFMSNAYKDKPSLPFKVPDSIKLIAVDSATGKITPGGTVIEAFKVNNVQMLENEDMIDNQDNNDIFDYVPSKEDQSQEIY GT:EXON 1|1-790:0| SW:ID PBPA_RICCN SW:DE RecName: Full=Penicillin-binding protein 1A; Short=PBP-1a; Short=PBP1a;Includes: RecName: Full=Penicillin-insensitive transglycosylase; EC=2.4.2.-; AltName: Full=Peptidoglycan TGase;Includes: RecName: Full=Penicillin-sensitive transpeptidase; EC=3.4.-.-; AltName: Full=DD-transpeptidase; SW:GN Name=mrcA; Synonyms=ponA; OrderedLocusNames=RC1245; SW:KW Antibiotic resistance; Cell inner membrane; Cell membrane; Cell shape;Cell wall biogenesis/degradation; Complete proteome;Glycosyltransferase; Hydrolase; Membrane; Multifunctional enzyme;Peptidoglycan synthesis; Signal-anchor; Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->790|PBPA_RICCN|0.0|100.0|790/790| GO:SWS:NREP 12 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 5->27| SEG 653->665|kklgkiiggktgt| BL:PDB:NREP 2 BL:PDB:REP 65->249|2oqoA|5e-40|47.2|176/181| BL:PDB:REP 402->747|3fwmA|2e-20|26.7|318/666| RP:PDB:NREP 3 RP:PDB:REP 65->248|3d3hA|2e-62|52.3|172/174| RP:PDB:REP 226->313|3by7D|4e-16|8.5|82/84| RP:PDB:REP 377->755|2bg1A|2e-57|19.8|358/455| RP:PFM:NREP 2 RP:PFM:REP 58->233|PF00912|1e-51|52.6|173/178|Transgly| RP:PFM:REP 420->688|PF00905|2e-35|40.9|242/289|Transpeptidase| HM:PFM:NREP 2 HM:PFM:REP 56->233|PF00912|3.6e-63|48.0|175/178|Transgly| HM:PFM:REP 419->711|PF00905|3.6e-38|34.7|259/304|Transpeptidase| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00912|IPR001264| GO:PFM GO:0009252|"GO:peptidoglycan biosynthetic process"|PF00912|IPR001264| GO:PFM GO:0009274|"GO:peptidoglycan-based cell wall"|PF00912|IPR001264| GO:PFM GO:0008658|"GO:penicillin binding"|PF00905|IPR001460| GO:PFM GO:0009273|"GO:peptidoglycan-based cell wall biogenesis"|PF00905|IPR001460| RP:SCP:NREP 3 RP:SCP:REP 45->261|2oluA1|3e-63|33.5|197/208|d.2.1.10| RP:SCP:REP 265->337|2c5wB1|1e-07|16.0|71/385|e.3.1.1| RP:SCP:REP 388->748|2oluA2|4e-55|18.4|332/400|e.3.1.1| HM:SCP:REP 215->745|2bg1A1|3.3e-117|43.3|379/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 2528 OP:NHOMOORG 837 OP:PATTERN -------------------------------------------------------------------- 333-322222222222222-23222322222233333444233322212224232111115522324744321222221131411111444214111--23443236515---------------2222212222222233---215333333223312122243224673111-11111-11232111124346666676666666665444446673434443222222444333333333333333333332223422323222233322222333333333323333333333333333333333333343333333331212111111211211211111131211322212233222531222212145-766422222555655545554544444444445-7777897765415555666666674534434444443451111111111112335------------2222122211112----1434534444478878756665774566663686467772222243444464442333222332222222222222453532133222222133333333355454434122131121121211111111111122443233322233444333233342422322--11213-1-11144333434444444444-4444444444444344444444334444444444444444443443332343143444544444411131111122223542433343313332322423343333333433334335444443444---------122242222233222444444433344441-136666661111111121--------------------------1-11111111--3 -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1--------------11-----1--4--1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 719 STR:RPRED 91.0 SQ:SECSTR ########################################ccccccccEEEEcTTccEEEEEcccccccccGGGccHHHHHHHHHHHcTTTTTcccccHHHHHHHHTTcTTccTccccccccccHHHHHHHTTcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccTTcccHHHHHHHHHcccGGGccHHHHHHHHTcTTcHHHHcTTTcHHHHHHHHHHHHHHHHHHTcccHHHHHHHTTcccGGGcccccTTTTGHHHHHHHHHHHTTccccHHHHTTcccEEEEcccHHHHHHHHHHHHHccccccTTEETTTcHHHHTcccGGGcccccHHHHccccccccGGGHHHHHHHHHHHHTTcGGGccHHHHHHHTcccEEEEcccHHHHHHHHHHHHHHGGcccccccEEEEEEEETTTccEEEEEccccTTTccccTTTTcccccGGGGHHHHHHHHHHTTccTTcEEEccccccTTcTTccccccccTTcccccEEEHHHHHHHTccHHHHHHHHHHHHTTccHHHHHHHTccccccTTGGGTTTccccHHHHHHHHHHHHTTTEEcccccEEEEEcTTccEEEEcccccEcHHHHHEEcccHHHHHHHHHHHHHHHHTcccccHHHHHHHHcHHHHTccTTGGGcccEEEEEccTTccEEEEEEEcccEEEEEEEEcTTcccccTTTTTTTHHHHHHHHHHHHHHHHcTTccccccTTcEEEEEETTTcccccEEEEccccEEcEEc############################### DISOP:02AL 116-119, 761-780, 784-790| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccEEEEEccccEEEEEcccccEEccHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHcEEEcccccHHHHHHHHHHHcccHHHccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHcccccccHHHHcHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEccccccccccHHHccccccccHHHHHHHHHHHHcccccccEEEcccEEEccccccccccEEEccccccccccHHHHHHHHccHHHHHHHHHccHHHHHHHHHHccccccccccccEEcccccccHHHHHHHHHHHHcccEEEccEEEEEEEcccccEEEEcccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccEEEEEEEEcccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEEEcccccEEcccccEEEEEEcccccccccccHHccccccccccccccccHHHHccc //