[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : murF
DDBJ      :murF         UDP-N-acetylmuramoylalanyl-D-glutamyl- 2,6-diaminopimelate--D-alanyl-D-alanyl ligase
Swiss-Prot:MURF_RICCN   RecName: Full=Probable UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase;         EC=6.3.2.10;AltName: Full=UDP-MurNAc-pentapeptide synthetase;AltName: Full=D-alanyl-D-alanine-adding enzyme;

Homologs  Archaea  0/68 : Bacteria  862/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.59.1c.72.2c.98.1
:449 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->446 2am1A PDBj 3e-36 31.9 %
:RPS:PDB   6->446 1e8cB PDBj 1e-61 17.7 %
:RPS:SCOP  6->95 1gg4A3  c.98.1.1 * 2e-19 28.4 %
:RPS:SCOP  99->310 1gg4A4  c.72.2.1 * 9e-27 30.2 %
:RPS:SCOP  315->449 1gg4A1  c.59.1.1 * 1e-17 28.2 %
:HMM:SCOP  3->96 1e8cA1 c.98.1.1 * 1.6e-19 32.3 %
:HMM:SCOP  98->313 1gg4A4 c.72.2.1 * 1e-43 29.6 %
:HMM:SCOP  314->449 1gg4A1 c.59.1.1 * 1.4e-33 35.6 %
:RPS:PFM   25->90 PF01225 * Mur_ligase 6e-07 42.4 %
:RPS:PFM   104->219 PF08245 * Mur_ligase_M 2e-14 40.4 %
:HMM:PFM   104->292 PF08245 * Mur_ligase_M 5.4e-41 33.1 181/188  
:HMM:PFM   314->394 PF02875 * Mur_ligase_C 6.6e-15 30.4 79/91  
:HMM:PFM   25->93 PF01225 * Mur_ligase 9.6e-15 36.2 69/76  
:BLT:SWISS 1->449 MURF_RICCN 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03449.1 GT:GENE murF GT:PRODUCT UDP-N-acetylmuramoylalanyl-D-glutamyl- 2,6-diaminopimelate--D-alanyl-D-alanyl ligase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(855594..856943) GB:FROM 855594 GB:TO 856943 GB:DIRECTION - GB:GENE murF GB:PRODUCT UDP-N-acetylmuramoylalanyl-D-glutamyl- 2,6-diaminopimelate--D-alanyl-D-alanyl ligase GB:PROTEIN_ID AAL03449.1 GB:DB_XREF GI:15620019 GB:GENE:GENE murF LENGTH 449 SQ:AASEQ MIWNSKTLSAVLGITISNSISCNEVQFNSKDVKKGNLFIALQGNRDGHDYVLDAIDKGAAAVIISKRVEINDKDKIILVDDCFEALQKMALYKRENSKAKFIAITGSVGKTSTKEALKVLLQHDFLVFASRGNFNNKLGMLINLASMADDTEYAIFELGMNHKGEIRELVQILKPNIAMITNISEAHLEFFNSLEEIAEAKCEIFANFSKNDIAVINADTNCYNKILSILKNLSITDIHSFGRSAKTSAELILYENLGEQVYLKYKINKKVLDVTIPFIPRHFTENYTGVLLIIDILGKDIEIAANHLANISPTKGRGEIINIQNCRVICDYYNASPQSMKAALEYLKQVPAENKTAIIGDMLELGENSKRLHEKLVQYILDAACSKVYLVGVNTKYINDLLPAKIAKKYFKNVDELITHITDLFEGNELILIKGSRGVKLDKIVDYYK GT:EXON 1|1-449:0| SW:ID MURF_RICCN SW:DE RecName: Full=Probable UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; EC=6.3.2.10;AltName: Full=UDP-MurNAc-pentapeptide synthetase;AltName: Full=D-alanyl-D-alanine-adding enzyme; SW:GN Name=murF; OrderedLocusNames=RC0911; SW:KW ATP-binding; Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->449|MURF_RICCN|0.0|100.0|449/449| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| BL:PDB:NREP 1 BL:PDB:REP 5->446|2am1A|3e-36|31.9|411/442| RP:PDB:NREP 1 RP:PDB:REP 6->446|1e8cB|1e-61|17.7|429/484| RP:PFM:NREP 2 RP:PFM:REP 25->90|PF01225|6e-07|42.4|66/76|Mur_ligase| RP:PFM:REP 104->219|PF08245|2e-14|40.4|114/187|Mur_ligase_M| HM:PFM:NREP 3 HM:PFM:REP 104->292|PF08245|5.4e-41|33.1|181/188|Mur_ligase_M| HM:PFM:REP 314->394|PF02875|6.6e-15|30.4|79/91|Mur_ligase_C| HM:PFM:REP 25->93|PF01225|9.6e-15|36.2|69/76|Mur_ligase| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF01225|IPR000713| GO:PFM GO:0009058|"GO:biosynthetic process"|PF01225|IPR000713| GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 3 RP:SCP:REP 6->95|1gg4A3|2e-19|28.4|88/98|c.98.1.1| RP:SCP:REP 99->310|1gg4A4|9e-27|30.2|202/206|c.72.2.1| RP:SCP:REP 315->449|1gg4A1|1e-17|28.2|131/135|c.59.1.1| HM:SCP:REP 3->96|1e8cA1|1.6e-19|32.3|93/101|c.98.1.1|1/1|MurE/MurF N-terminal domain| HM:SCP:REP 98->313|1gg4A4|1e-43|29.6|213/214|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 314->449|1gg4A1|1.4e-33|35.6|132/135|c.59.1.1|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 1103 OP:NHOMOORG 867 OP:PATTERN -------------------------------------------------------------------- 1212211111111111111-11--111111111212-1111--111111111111111111111111111111111111111112112333313222--213221322122111111111111121111111111122222---211111111111111111111111111111111211111111111221112242423323342232122324332115222111111211222222222222222223111211111111111111111111111111111111111111111111111111111111111111111112422211111111111211211112221111122232122112332212212-111121221111111111111111111111111-111111111111111111211111111211121111111111111111111111112------1121212212112111211111111111111111111111111111111111111111111111111111111121111121111111111113111112111112-1111-211111-112111121111111111111111111111111111111211112112112212121222122221221-11111-1-1-111111111111111111-11111111111111111111111111111111111111111111111111111111111111111211211111312211111222111122222222111111111111111111111121211111222222222222211111222221111111111111122211111112222222211--------------------------1432111111111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------3-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 443 STR:RPRED 98.7 SQ:SECSTR ####HccHHHHHTTTcTTcccccccEccGGGccTTcEEEEccccccGGGGHHHHHHTTccEEEEEcTTEEETTEEEEEETTHHHHHHHHHHTTcGGGccEEHHHHHHTTccEEEcTTccEETTcccEEccccccccHHHHHHHHHHHHHTTccEEEEccccHHHHHTTTTTTccccEEEEcccccccHHHHccHHHHHHHHHHHccccccccEEEEETTcHHHHHHHTTcTTEEcccccTTTccEEEEEEEEEEccccEEEEEEEEEETTccEEEEEcccHHHHHHHHHHHHHHHHTTccHHHHHHHGGGccccTTcEEEccTTccEEEEEEccccHHHHHHHHHHHHHTccccEEEEEccccccccTHHHHHHHHHHHccEEEEccccccTccHHHHHHHHHTTccTTEEccHHHHHHHHHHccTTTcEEEEEccTTccEEEETTH## PSIPRED ccccHHHHHHHHccccccccEEEEEEEcccccccccEEEEEcccccHHHHHHHHHHcccEEEEEcccccccccccEEEEccHHHHHHHHHHHcccHHccEEEEEEccccHHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHccccccEEEEEEEccccccHHHHHccccccEEEEccccHHHHHHcccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEccccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEcccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHcccccEEEEccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHc //