[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : ndk
DDBJ      :ndk          nucleoside diphosphate kinase
Swiss-Prot:NDK_RICRS    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  63/68 : Bacteria  798/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:140 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->138 1nhkL PDBj 1e-36 50.7 %
:RPS:PDB   4->140 2cwkB PDBj 3e-46 45.3 %
:RPS:SCOP  1->140 1b4sA  d.58.6.1 * 3e-44 38.6 %
:HMM:SCOP  1->140 1w7wA_ d.58.6.1 * 2.3e-49 46.4 %
:RPS:PFM   6->133 PF00334 * NDK 1e-33 51.6 %
:HMM:PFM   5->138 PF00334 * NDK 3.4e-53 55.2 134/135  
:BLT:SWISS 1->140 NDK_RICRS 1e-76 100.0 %
:PROS 114->122|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02621.1 GT:GENE ndk GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 76545..76967 GB:FROM 76545 GB:TO 76967 GB:DIRECTION + GB:GENE ndk GB:PRODUCT nucleoside diphosphate kinase GB:PROTEIN_ID AAL02621.1 GB:DB_XREF GI:15619121 GB:GENE:GENE ndk LENGTH 140 SQ:AASEQ MTIQYTFSMIKPDAIKRNKIGQVNTYLENAGLKIVAQKMKFLTKYEAACFYDEHRARPFFNSLVEYITSGAVVLQVLKGEDAITLNRTVMGATNPAEAEAGTIRKDLGESIEANSIHGSDSENSAKREIEFFFNKSEIIE GT:EXON 1|1-140:0| SW:ID NDK_RICRS SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=A1G_00525; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|NDK_RICRS|1e-76|100.0|140/140| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 114->122|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 3->138|1nhkL|1e-36|50.7|136/143| RP:PDB:NREP 1 RP:PDB:REP 4->140|2cwkB|3e-46|45.3|137/152| RP:PFM:NREP 1 RP:PFM:REP 6->133|PF00334|1e-33|51.6|128/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 5->138|PF00334|3.4e-53|55.2|134/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->140|1b4sA|3e-44|38.6|140/150|d.58.6.1| HM:SCP:REP 1->140|1w7wA_|2.3e-49|46.4|140/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1610 OP:NHOMOORG 1056 OP:PATTERN 11-1111111111111---111111111111111111111111111111111111111111111-111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 1122434-61112241111111111111111111111111111111-1111111-111111111111111111111111111111111-111111122211135431364B8999BA5365282AB4D7fcF-F6F4447C44C946742514B3947799635571222511742443O2223295881593333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 140 STR:RPRED 100.0 SQ:SECSTR GGGEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGccc PSIPRED cccEEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHccccccHHHHHHcccccEEEEEEEcccHHHHHHHHHccccHHHcccccccccccccccccEEcccccHHHHHHHHHHHccHHHHcc //