[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : nuoB
DDBJ      :nuoB         NADH dehydrogenase I chain B
Swiss-Prot:NUOB_RICRS   RecName: Full=NADH-quinone oxidoreductase subunit B;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B;

Homologs  Archaea  67/68 : Bacteria  605/915 : Eukaryota  143/199 : Viruses  0/175   --->[See Alignment]
e.19.1
:174 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->161 3i9v6 PDBj 2e-31 48.4 %
:RPS:PDB   33->162 1e3dA PDBj 6e-33 17.7 %
:RPS:SCOP  19->171 2fug61  e.19.1.2 * 3e-51 55.1 %
:HMM:SCOP  17->164 2fug61 e.19.1.2 * 3e-63 54.4 %
:RPS:PFM   48->156 PF01058 * Oxidored_q6 3e-21 47.7 %
:HMM:PFM   47->156 PF01058 * Oxidored_q6 9.1e-25 30.9 110/131  
:BLT:SWISS 1->174 NUOB_RICRS e-102 100.0 %
:PROS 128->144|PS01150|COMPLEX1_20K

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03022.1 GT:GENE nuoB GT:PRODUCT NADH dehydrogenase I chain B GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(479792..480316) GB:FROM 479792 GB:TO 480316 GB:DIRECTION - GB:GENE nuoB GB:PRODUCT NADH dehydrogenase I chain B GB:PROTEIN_ID AAL03022.1 GB:DB_XREF GI:15619558 GB:GENE:GENE nuoB LENGTH 174 SQ:AASEQ MKNNFYQEDELLSNELSNRGFLLTKVDDVIGWARANSLWPMTFGLACCAVEMMQAAASRYDMDRFGMLFRPSPRQSDLMIVAGTLTNKMAPALRKVYDQMAEPKWVLSMGSCANGGGYYHFSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGLMQLQKKIKRTTGFKYDARQTH GT:EXON 1|1-174:0| SW:ID NUOB_RICRS SW:DE RecName: Full=NADH-quinone oxidoreductase subunit B; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B; SW:GN Name=nuoB; OrderedLocusNames=A1G_02750; SW:KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Iron;Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone;Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->174|NUOB_RICRS|e-102|100.0|174/174| GO:SWS:NREP 10 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 128->144|PS01150|COMPLEX1_20K|PDOC00858| BL:PDB:NREP 1 BL:PDB:REP 20->161|3i9v6|2e-31|48.4|126/145| RP:PDB:NREP 1 RP:PDB:REP 33->162|1e3dA|6e-33|17.7|130/262| RP:PFM:NREP 1 RP:PFM:REP 48->156|PF01058|3e-21|47.7|109/128|Oxidored_q6| HM:PFM:NREP 1 HM:PFM:REP 47->156|PF01058|9.1e-25|30.9|110/131|Oxidored_q6| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 1 RP:SCP:REP 19->171|2fug61|3e-51|55.1|136/144|e.19.1.2| HM:SCP:REP 17->164|2fug61|3e-63|54.4|147/0|e.19.1.2|1/1|HydA/Nqo6-like| OP:NHOMO 1250 OP:NHOMOORG 815 OP:PATTERN 11313121222222213112222121111211212223222222132411233132232532121-11 22212---------12122-21--11222221111-11111111-1--1-----------22212112221--------21111211211111---1--1-11--22211--------------1111111111212222233321211211111111111111212111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112221----22--211--23-111111111212111112533311111111111-11111111111111113222212222111111222211122222222533112231111111111111111111111111111111111-111111111111222211123233221131122111111111111231111111112111111111122211-1-2-1-442223-433232418333313-2122211111111111111111242333221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222232222331-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111112-111111------------------------------------121111-11-251 ----111-211-1112121112222312212122221222122211-111223211222111111----1--111------11111---12111111111111112-1-32211111-------22-2-4J1-321----3--2------1--1-111111-1111232121121111-----1124-41131134231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 84.5 SQ:SECSTR ###############cTTTHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEHHTcccccEEEEEccEEcTGGGHHHHHHHHGGGccEEEEEcHHHHHcGGGGcTTcHHHHHGGGTcccEEEccccccHHHHHHHHHHHHTTccc############ DISOP:02AL 1-5, 7-15, 162-174| PSIPRED ccccccccccccccccccccEEEEEHHHHHHHHHccccEEEEcccccHHHHHHHHccHHccHHHccEEEccccccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccHHHHccc //