[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : nuoE
DDBJ      :nuoE         NADH dehydrogenase I chain E
Swiss-Prot:NUOE_RICCN   RecName: Full=NADH-quinone oxidoreductase subunit E;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit E;AltName: Full=NDH-1 subunit E;

Homologs  Archaea  6/68 : Bacteria  540/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->149 3iam2 PDBj 6e-28 39.9 %
:RPS:PDB   80->163 2auvA PDBj 5e-28 28.6 %
:RPS:SCOP  10->165 2fug21  c.47.1.21 * 1e-42 36.1 %
:HMM:SCOP  10->167 2fug21 c.47.1.21 * 5.7e-56 46.5 %
:RPS:PFM   20->163 PF01257 * Complex1_24kDa 6e-42 56.7 %
:HMM:PFM   19->165 PF01257 * Complex1_24kDa 1.4e-66 64.6 144/145  
:BLT:SWISS 1->167 NUOE_RICCN 7e-98 100.0 %
:PROS 122->140|PS01099|COMPLEX1_24K

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03019.1 GT:GENE nuoE GT:PRODUCT NADH dehydrogenase I chain E GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(476884..477387) GB:FROM 476884 GB:TO 477387 GB:DIRECTION - GB:GENE nuoE GB:PRODUCT NADH dehydrogenase I chain E GB:PROTEIN_ID AAL03019.1 GB:DB_XREF GI:15619555 GB:GENE:GENE nuoE LENGTH 167 SQ:AASEQ MNTKITNFTFDKKNLNLAEEIIKKYPPHGKRSAILPLLDLAQRQNGGWLPVPAIEYVANMLAMPYIRAYEVATFYTMFNLKRVGKYHIQVCTTTPCWLRGSDDIMKICEKKLGVKLKETTEDQKFTLSEIECLGACVNAPVVQINDDYYEDLTQDKMGKIIDKLQND GT:EXON 1|1-167:0| SW:ID NUOE_RICCN SW:DE RecName: Full=NADH-quinone oxidoreductase subunit E; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit E;AltName: Full=NDH-1 subunit E; SW:GN Name=nuoE; OrderedLocusNames=RC0481; SW:KW 2Fe-2S; Complete proteome; Iron; Iron-sulfur; Metal-binding; NAD;Oxidoreductase; Quinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->167|NUOE_RICCN|7e-98|100.0|167/167| GO:SWS:NREP 6 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| PROS 122->140|PS01099|COMPLEX1_24K|PDOC00843| BL:PDB:NREP 1 BL:PDB:REP 10->149|3iam2|6e-28|39.9|138/179| RP:PDB:NREP 1 RP:PDB:REP 80->163|2auvA|5e-28|28.6|84/85| RP:PFM:NREP 1 RP:PFM:REP 20->163|PF01257|6e-42|56.7|141/142|Complex1_24kDa| HM:PFM:NREP 1 HM:PFM:REP 19->165|PF01257|1.4e-66|64.6|144/145|Complex1_24kDa| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01257|IPR002023| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01257|IPR002023| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01257|IPR002023| RP:SCP:NREP 1 RP:SCP:REP 10->165|2fug21|1e-42|36.1|155/178|c.47.1.21| HM:SCP:REP 10->167|2fug21|5.7e-56|46.5|157/0|c.47.1.21|1/1|Thioredoxin-like| OP:NHOMO 940 OP:NHOMOORG 721 OP:PATTERN -----------------------------1----1---------1--1----------1-1------- 11211---------11111-11--12111111111111111111-1--1-----------11111111211----------1-11112--1--1-----1-11--21111--------------1-----1---1-22222444111111111--11------11--11--------------11111331--------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2112--23113436331211121--3--111111111231111122222211111111111-11111112121122213332223322111112323311111111111322-21111111111111111111111111111111111111-22212111111111111111111111111222211111221111111222211222111111111112111131-2-1--3-----343243265111111641--1---------------------11112---2-----------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1-1111111111111112--11---------------11111111111-1111111121111-1111111111111--------------111111111111111111111111------------------------------------3223333233221 ----111-211-111111111111111111111111111111111111111111111111-1111----1--111------1111111-12111111111111112-111211111111111111113-3B1-3121-1111131111111111111111111111221251111111171111121321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 91.0 SQ:SECSTR #########ccTTH#HHHHHHHTTccTTcGGGGHHHHHHHHHHHHc#cccHHHHHHHHHHHTccHHHHHHHHTTcccccccccccccEEccccHHHHTTTHHHHHHHHHHHHccccccccccccccccccccccccTTccccEEGGGccccccccHHHHHHHH#### DISOP:02AL 1-4, 166-167| PSIPRED cccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccEEEEccEEEccccHHHHHHHHHHHHcc //