[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : omp
DDBJ      :omp          17 kD surface antigen precursor
Swiss-Prot:17KD_RICSI   RecName: Full=17 kDa surface antigen;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->72 PF05433 * Rick_17kDa_Anti 7.6e-13 53.5 43/44  
:BLT:SWISS 1->159 17KD_RICSI 2e-62 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03825.1 GT:GENE omp GT:PRODUCT 17 kD surface antigen precursor GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1193390..1193869 GB:FROM 1193390 GB:TO 1193869 GB:DIRECTION + GB:GENE omp GB:PRODUCT 17 kD surface antigen precursor GB:PROTEIN_ID AAL03825.1 GB:DB_XREF GI:15620425 GB:GENE:GENE omp LENGTH 159 SQ:AASEQ MKLLSKIMIIALATSMLQACNGPGGMNKQGTGTLLGGAGGALLGSQFGKGKGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN GT:EXON 1|1-159:0| SW:ID 17KD_RICSI SW:DE RecName: Full=17 kDa surface antigen;Flags: Precursor; SW:GN Name=omp; ORFNames=rsib_orf.806; SW:KW Cell membrane; Cell outer membrane; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->159|17KD_RICSI|2e-62|100.0|159/159| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| TM:NTM 2 TM:REGION 1->23| TM:REGION 52->74| SEG 30->44|gtgtllggaggallg| SEG 48->74|gkgkgqlvgvgvgallgavlggqigag| HM:PFM:NREP 1 HM:PFM:REP 30->72|PF05433|7.6e-13|53.5|43/44|Rick_17kDa_Anti| OP:NHOMO 60 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------11--11-111111111111---------1-3-------------11--------------------------13-------------1111111111111-------------------------------------------------------------------------------------11----------------2------------------------------------1---------1----------------------11-1---------------------------------------------------------------------------------------------111111111--------------------------------------------------------------1--------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 74-77| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccEEEEEEEccccccccccEEccEEEEEEEccEEEEEEEcccccccccEEEEc //