[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : priA
DDBJ      :priA         possible primosomal protein N
Swiss-Prot:PRIA_RICCN   RecName: Full=Primosomal protein N';         EC=3.6.1.-;AltName: Full=ATP-dependent helicase priA;AltName: Full=Replication factor Y;

Homologs  Archaea  0/68 : Bacteria  816/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.37.1
:648 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->99 2d7hA PDBj 2e-06 34.4 %
:BLT:PDB   110->243 1gm5A PDBj 7e-11 37.3 %
:BLT:PDB   416->519 1d2mA PDBj 3e-04 31.2 %
:RPS:PDB   3->98 2d7hD PDBj 1e-24 31.2 %
:RPS:PDB   118->556 1br2A PDBj 3e-44 12.1 %
:RPS:SCOP  121->294 2eyqA3  c.37.1.19 * 2e-36 28.7 %
:RPS:SCOP  349->477 2gnrA1  b.40.4.15 * 4e-32 11.6 %
:HMM:SCOP  66->350 1z3iX2 c.37.1.19 * 3.9e-42 23.4 %
:HMM:SCOP  378->559 1gkuB2 c.37.1.16 * 1.4e-20 24.9 %
:RPS:PFM   126->189 PF04851 * ResIII 3e-05 42.2 %
:HMM:PFM   125->284 PF00270 * DEAD 2.5e-18 21.6 148/167  
:HMM:PFM   438->511 PF00271 * Helicase_C 2e-06 25.8 62/78  
:HMM:PFM   347->367 PF07503 * zf-HYPF 0.00039 47.6 21/35  
:BLT:SWISS 1->648 PRIA_RICCN 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03338.1 GT:GENE priA GT:PRODUCT possible primosomal protein N GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(754229..756175) GB:FROM 754229 GB:TO 756175 GB:DIRECTION - GB:GENE priA GB:PRODUCT possible primosomal protein N GB:PROTEIN_ID AAL03338.1 GB:DB_XREF GI:15619899 GB:GENE:GENE priA LENGTH 648 SQ:AASEQ MRIAKILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIVWELVSNSEAKKIKTIRVKVPLNLNITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEKPIKVKEQKVNNNFVLPDLSEEQKQAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVLVMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFLPFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEIGKYQLVTLVNRYKNVDLPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNRRGYAPLMLCKACGYRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTICGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGYHFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIFSYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIARDMVRIAPKANVKILGPASSLMSKLAGKYRYRILIIANKKFNLQKYLKFWLSLIKIPSFCHLKIDIDPKSFY GT:EXON 1|1-648:0| SW:ID PRIA_RICCN SW:DE RecName: Full=Primosomal protein N'; EC=3.6.1.-;AltName: Full=ATP-dependent helicase priA;AltName: Full=Replication factor Y; SW:GN Name=priA; OrderedLocusNames=RC0800; SW:KW ATP-binding; Complete proteome; DNA replication; DNA-binding;Helicase; Hydrolase; Metal-binding; Nucleotide-binding; Primosome;Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->648|PRIA_RICCN|0.0|100.0|648/648| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0004386|"GO:helicase activity"|Helicase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006269|"GO:DNA replication, synthesis of RNA primer"|Primosome| GO:SWS GO:0005658|"GO:alpha DNA polymerase:primase complex"|Primosome| SEG 316->329|keklsknsylskll| BL:PDB:NREP 3 BL:PDB:REP 4->99|2d7hA|2e-06|34.4|93/102| BL:PDB:REP 110->243|1gm5A|7e-11|37.3|134/729| BL:PDB:REP 416->519|1d2mA|3e-04|31.2|96/552| RP:PDB:NREP 2 RP:PDB:REP 3->98|2d7hD|1e-24|31.2|96/102| RP:PDB:REP 118->556|1br2A|3e-44|12.1|438/673| RP:PFM:NREP 1 RP:PFM:REP 126->189|PF04851|3e-05|42.2|64/177|ResIII| HM:PFM:NREP 3 HM:PFM:REP 125->284|PF00270|2.5e-18|21.6|148/167|DEAD| HM:PFM:REP 438->511|PF00271|2e-06|25.8|62/78|Helicase_C| HM:PFM:REP 347->367|PF07503|0.00039|47.6|21/35|zf-HYPF| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF04851|IPR006935| GO:PFM GO:0005524|"GO:ATP binding"|PF04851|IPR006935| GO:PFM GO:0016787|"GO:hydrolase activity"|PF04851|IPR006935| RP:SCP:NREP 2 RP:SCP:REP 121->294|2eyqA3|2e-36|28.7|164/233|c.37.1.19| RP:SCP:REP 349->477|2gnrA1|4e-32|11.6|129/137|b.40.4.15| HM:SCP:REP 66->350|1z3iX2|3.9e-42|23.4|265/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 378->559|1gkuB2|1.4e-20|24.9|173/248|c.37.1.16|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 959 OP:NHOMOORG 819 OP:PATTERN -------------------------------------------------------------------- 111--122111-1---------------------------------1----11--1--1-------------------1111---21-112111111--2112111111111111111111111111111111222111111211121111112211221212121211112112221122122212211211111111111111111111111111111111111111112111111111111111111111131122112131111221121112111111111111111211111111111111111111111111111112111111112111121221111112131112222221212212221112111111111111211111121211211121111111-11111111111111111111111111111111111111111111111111111111121111121111111111111111121111111121111111111111111111111111111111111111111111111111111121111111111111112122111111111111111111211111111122112111111212121111121221111212112211122222222222212222221-121111--11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--21111112222111111221111111-111211111111111111111111111111111111111111211111111122111111111111111111111111111111211211111111---------------------2222123232211 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-1---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 618 STR:RPRED 95.4 SQ:SECSTR cccccccccccccccccccccTTccccTTcEEEEEEccEEEEEEcccccccccTTccccccEEccccccccHHHHHHHHHHHHHTTccHHHHHHHHHHEEEEccccccccccHHHHHccccHHHHHHHHHHHHHHHTccEEEEccTTccHHHHHHHHHHHHHHHHTTHHHHHHHHHEEcccccTTEEccEEEEEEcTTccEEEEEEEEEcccGGGGTcccTTccccHHHHHHHHHcTTcccTTTcTTcTTcccccccccHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHTTTTEEEEEEcTTHHHHHHccccHHHHHHHHTcccHHHHHHTcccHHHHHHHHHHHTcEEEEEEEEcccccccTTcccHHHHHHHHHHHTTHHHHHHHHHHcccEEEcGcTTccccTTTTcccHHHHHHHHTHHHHTccccHHHHHHHHHTTccTTcGGGGTcccGGG############################## DISOP:02AL 648-649| PSIPRED cEEEEEEEcccccccEEEEEccccccccccEEEEEccccEEEEEEEEEcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHccccccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHcccccEEEEEcHHHHccHHHccEEEEEccccccccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHcccccEEEEcccccccccccEEEEEcccHHccccccccHHHHHHHHHHHHccccEEEEEcccccHHHEEccccccccccccccccEEEEcccccEEEcccccccccHHHccccccccEEEEEcccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHcccccEEEEcHHHccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccHHHHHHHHHccHHHHHHHHHHHHHHccccccEEEEEEEEEcccHHHHHHHHHHHHHHccccccEEEccccccHHHcccEEEEEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEcccccc //