[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rfbE
DDBJ      :rfbE         O-antigen export system ATP-binding protein RfbE
Swiss-Prot:             

Homologs  Archaea  63/68 : Bacteria  881/915 : Eukaryota  115/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.41.3
:249 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   57->239 3dhwC PDBj 2e-13 29.2 %
:RPS:PDB   58->244 2ccgA PDBj 1e-26 9.1 %
:RPS:SCOP  52->227 1sgwA  c.37.1.12 * 1e-24 20.9 %
:RPS:SCOP  205->243 1uouA3  d.41.3.1 * 1e-06 17.9 %
:HMM:SCOP  46->237 1pf4A1 c.37.1.12 * 3.1e-39 29.3 %
:RPS:PFM   71->177 PF00005 * ABC_tran 2e-05 32.4 %
:HMM:PFM   71->178 PF00005 * ABC_tran 4.7e-10 28.2 103/118  
:HMM:PFM   160->221 PF02463 * SMC_N 0.0002 33.3 60/220  
:HMM:PFM   59->79 PF08477 * Miro 0.00069 42.9 21/119  
:BLT:SWISS 56->244 RFBB_MYXXA 2e-35 39.7 %
:PROS 152->166|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02541.1 GT:GENE rfbE GT:PRODUCT O-antigen export system ATP-binding protein RfbE GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 1367..2116 GB:FROM 1367 GB:TO 2116 GB:DIRECTION + GB:GENE rfbE GB:PRODUCT O-antigen export system ATP-binding protein RfbE GB:PROTEIN_ID AAL02541.1 GB:DB_XREF GI:15619035 GB:GENE:GENE rfbE LENGTH 249 SQ:AASEQ MSLSYPKVFIEITNGYVEGIDTHKRAQGLKHFFLKKGVSLSPNIPILNNINFSCYEGEKIAFIGSNGSGKSSFLKLIAGIYPLKSGTVKVHGDIAAIIDMGVGFESEQTGRENIKMLMLYNNMLDKYSKKIEKEIIDFSELGSKIDLPIKIYSSGMLSRLAFSVSIFQNPQILLLDEVFAAGDSYFIEKSLSLMKNKFKNTPISIIVSHQEEIIKDNCDRCILLKDGNIIGDGTPSEMFKIYNQQQGNS GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 56->244|RFBB_MYXXA|2e-35|39.7|189/437| PROS 152->166|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 39->51|slspnipilnnin| BL:PDB:NREP 1 BL:PDB:REP 57->239|3dhwC|2e-13|29.2|178/343| RP:PDB:NREP 1 RP:PDB:REP 58->244|2ccgA|1e-26|9.1|187/202| RP:PFM:NREP 1 RP:PFM:REP 71->177|PF00005|2e-05|32.4|105/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 71->178|PF00005|4.7e-10|28.2|103/118|ABC_tran| HM:PFM:REP 160->221|PF02463|0.0002|33.3|60/220|SMC_N| HM:PFM:REP 59->79|PF08477|0.00069|42.9|21/119|Miro| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 52->227|1sgwA|1e-24|20.9|172/200|c.37.1.12| RP:SCP:REP 205->243|1uouA3|1e-06|17.9|39/99|d.41.3.1| HM:SCP:REP 46->237|1pf4A1|3.1e-39|29.3|188/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 7826 OP:NHOMOORG 1059 OP:PATTERN 33224-247776657684--272964587326747232233129947A58QLI237677453226--3 54B1667722576441111-17222D111114898A7DC933254C646764A9B636115842953A8F5766686672757244324444-3112--7599536562821111113324444453137111456544A8566B26988BA855443-1-2-55-6A979362444544544521-1G613ELSSSSSTVXNXXVSPWMEGGLMUVX7AGPQHGBGHFFFTRGFFFFEDFDCFFFDBCE9ADE759BA9597CBB998C4C86G6DEEFGIFFCGCLKGFFEDEJFEGECBBBBCCCCDCBBFEGFFFIHIHDGGSRQPQROMOHNECOLLBHIGQFFFJ9ED75MJD695F445HACF53B368366222-1135KCD315694569A8A99A99BF-66665784AE34WLLLMNGTQNKJJ762185IB7AAA7B44444444522429231112322222--1111111111111313131232368745CABCCB9B9BAEECECBBC9FADI7399-1786366665CFAKB6762223-533443324354536BB285A72598775777646B14334352A8777A655556523111111133243326972745264913552134343443564731-34312------9A981757777777778-6768967877778767778EGGBD5586446465665556565755467764-6AAAAAAAAAAA12213333355557-88F6679A92654628A755665362225655453B9B94555257843313333358CBE78878BBBCD33111111113222--48333356-112-221H-812324-1111221111224211---BAK9AEDEBD355 ----33--1---131--------1---------1111211111---1-----------1-111-1111--1----------211--11---------------2-1---3421422B3332163B92F3ImC1B4B5414723H642111913S133261-334-1-322P5371311-8111--267I1D6--1221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 240-249| PSIPRED cccccccEEEEEEEEEEEEcccccHHHHHHHHHHHccEEEcccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEccEEEEEEEEEEEEcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHccccHHccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHEEEEEccEEEEEccHHHHHHccccccccc //