[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rlpA
DDBJ      :rlpA         rare lipoprotein A precursor
Swiss-Prot:RLPA_RICCN   RecName: Full=RlpA-like protein;

Homologs  Archaea  0/68 : Bacteria  509/915 : Eukaryota  2/199 : Viruses  1/175   --->[See Alignment]
b.52.1
:320 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   168->265 3d30A PDBj 4e-15 19.6 %
:RPS:SCOP  145->263 1n10A2  b.52.1.3 * 2e-22 20.4 %
:HMM:SCOP  163->266 1bw3A_ b.52.1.2 * 1.6e-10 28.7 %
:RPS:PFM   186->257 PF03330 * DPBB_1 2e-05 42.4 %
:HMM:PFM   166->259 PF03330 * DPBB_1 1.2e-22 43.6 78/78  
:HMM:PFM   233->305 PF04887 * Pox_M2 0.00015 23.9 71/197  
:HMM:PFM   100->115 PF08085 * Entericidin 0.0001 50.0 16/42  
:BLT:SWISS 1->320 RLPA_RICCN e-167 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03075.1 GT:GENE rlpA GT:PRODUCT rare lipoprotein A precursor GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(528324..529286) GB:FROM 528324 GB:TO 529286 GB:DIRECTION - GB:GENE rlpA GB:PRODUCT rare lipoprotein A precursor GB:PROTEIN_ID AAL03075.1 GB:DB_XREF GI:15619615 GB:GENE:GENE rlpA LENGTH 320 SQ:AASEQ MIIVKNHKFKLDLLQNEANKEKFEGNTACSTAAYTLVREDASTGLTYTADISKVGNQISGEPAQRIKIREHRRIPKFDLPNLKVSKVYKLPLEASYAKGLLLLLIFCFGLSGCNTSKRLPYSHKYSYKELSKDDPHNLTYKGHYKVGKNYKIKGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAHKTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQRAAEILAFKNQGITKVKIEYLPNETEKFLKNINLKKPQSKTLAKNSKKSSSNKVTNNNKCSVNCHIKLINLKYKLAVTP GT:EXON 1|1-320:0| SW:ID RLPA_RICCN SW:DE RecName: Full=RlpA-like protein; SW:GN Name=rlpA; OrderedLocusNames=RC0537; SW:KW Complete proteome; Repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->320|RLPA_RICCN|e-167|100.0|320/320| TM:NTM 1 TM:REGION 94->116| SEG 100->104|lllll| SEG 280->305|sktlaknskksssnkvtnnnkcsvnc| RP:PDB:NREP 1 RP:PDB:REP 168->265|3d30A|4e-15|19.6|92/208| RP:PFM:NREP 1 RP:PFM:REP 186->257|PF03330|2e-05|42.4|66/80|DPBB_1| HM:PFM:NREP 3 HM:PFM:REP 166->259|PF03330|1.2e-22|43.6|78/78|DPBB_1| HM:PFM:REP 233->305|PF04887|0.00015|23.9|71/197|Pox_M2| HM:PFM:REP 100->115|PF08085|0.0001|50.0|16/42|Entericidin| RP:SCP:NREP 1 RP:SCP:REP 145->263|1n10A2|2e-22|20.4|108/133|b.52.1.3| HM:SCP:REP 163->266|1bw3A_|1.6e-10|28.7|101/125|b.52.1.2|1/1|Barwin-like endoglucanases| OP:NHOMO 695 OP:NHOMOORG 512 OP:PATTERN -------------------------------------------------------------------- 221---------------------------------------------------------1--2------1-----------321--------1-----1121--11111---------------22232223212----------1111111111122211121111111-1-----1----11------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------1-----1--1-1-111111111223442222322222222222222-32443323221122221121112222111----------222222222221212211--------1122331532113411111-1-131111111111111111111331111111111112--11113111111-2-1111111111111111111212-1211112212222-111-11112111111-1111111111111111111111111122222111121221222212122221111211--11111------11111111111111111-112111111111111111111111111111111111111111111111111--111111111111---1111112222211221111111111-111111111112222122222222222222222----------1111111112121111111111111111--1-1111111111111111------------------------------------1-2 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------2---------- -----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 30.6 SQ:SECSTR #######################################################################################################################################################################EEEEEEccTTcccTTccEEEcHHHHTGGGcTTTTHHHHcGTTcEEEEEETTEEEEEEEEEEcTTccTTcEEEcHHHHHHHccGGGccEEEEEEEEccc####################################################### DISOP:02AL 63-64, 115-145, 266-299| PSIPRED cEEEEcHHHHHHHHcccccHHHHEEcccccHHHHHHHHHHcccccEEEEEHHHHccccccccccEEEcccHHEEEEEEHHHccccccHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEcEEEEEccccccEEEEEEEEEccccccccccccccccEEccccccccccccccccEEEEEEccccEEEEEEEccccccccccEEEccHHHHHHHccccccEEEEEEEEEcccHHHHHHHccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEccEEEEEEcc //