[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rplL
DDBJ      :rplL         50S ribosomal protein L7/L12
Swiss-Prot:RL7_RICCN    RecName: Full=50S ribosomal protein L7/L12;

Homologs  Archaea  0/68 : Bacteria  356/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.108.1d.45.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->118 1rquA PDBj 3e-08 51.6 %
:RPS:PDB   18->140 1dd3A PDBj 7e-10 42.3 %
:RPS:SCOP  73->140 1ctfA  d.45.1.1 * 2e-07 47.1 %
:HMM:SCOP  17->76 1dd3A1 a.108.1.1 * 5.4e-15 59.6 %
:HMM:SCOP  73->140 1ctfA_ d.45.1.1 * 3.6e-23 64.7 %
:RPS:PFM   74->140 PF00542 * Ribosomal_L12 1e-04 55.2 %
:HMM:PFM   73->140 PF00542 * Ribosomal_L12 1.3e-30 67.6 68/68  
:HMM:PFM   5->71 PF02249 * MCR_alpha 2.4e-05 25.4 67/127  
:BLT:SWISS 16->140 RL7_RICCN 6e-39 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02718.1 GT:GENE rplL GT:PRODUCT 50S ribosomal protein L7/L12 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 177810..178232 GB:FROM 177810 GB:TO 178232 GB:DIRECTION + GB:GENE rplL GB:PRODUCT 50S ribosomal protein L7/L12 GB:PROTEIN_ID AAL02718.1 GB:DB_XREF GI:15619227 GB:GENE:GENE rplL LENGTH 140 SQ:AASEQ MLVISQYKKSKKEKIMADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAVGAAAPAAEAVAEKTEFEVVLTAAGDKKVEVIKVVKDITGLGLIEAKKLVDEAPKPIKSNVKKAEADEIKGKLEAAGAKVELK GT:EXON 1|1-140:0| SW:ID RL7_RICCN SW:DE RecName: Full=50S ribosomal protein L7/L12; SW:GN Name=rplL; OrderedLocusNames=RC0180; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 16->140|RL7_RICCN|6e-39|100.0|125/125| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| TM:NTM 1 TM:REGION 46->68| SEG 46->70|gvsaaapvavaavgaaapaaeavae| SEG 83->95|dkkvevikvvkdi| BL:PDB:NREP 1 BL:PDB:REP 21->118|1rquA|3e-08|51.6|93/120| RP:PDB:NREP 1 RP:PDB:REP 18->140|1dd3A|7e-10|42.3|123/128| RP:PFM:NREP 1 RP:PFM:REP 74->140|PF00542|1e-04|55.2|67/68|Ribosomal_L12| HM:PFM:NREP 2 HM:PFM:REP 73->140|PF00542|1.3e-30|67.6|68/68|Ribosomal_L12| HM:PFM:REP 5->71|PF02249|2.4e-05|25.4|67/127|MCR_alpha| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00542|IPR013823| GO:PFM GO:0005622|"GO:intracellular"|PF00542|IPR013823| GO:PFM GO:0005840|"GO:ribosome"|PF00542|IPR013823| GO:PFM GO:0006412|"GO:translation"|PF00542|IPR013823| RP:SCP:NREP 1 RP:SCP:REP 73->140|1ctfA|2e-07|47.1|68/68|d.45.1.1| HM:SCP:REP 17->76|1dd3A1|5.4e-15|59.6|57/57|a.108.1.1|1/2|Ribosomal protein L7/12, oligomerisation (N-terminal) domain| HM:SCP:REP 73->140|1ctfA_|3.6e-23|64.7|68/68|d.45.1.1|1/1|ClpS-like| OP:NHOMO 356 OP:NHOMOORG 356 OP:PATTERN -------------------------------------------------------------------- -111----------------------------1-----------------------1---------1------------1---11111111111--1---111111111-1--------------11111-1111----------1-11----11--------1------1------------11111---1-----------------------------11111--11-------------------11---1-1--11111--11--1--111111111-----------------------------------------1111111111111111111-1111-1----1-1111---1-1-1111--111----111111--11111-1111111111111111-111111111111----11-111--11-1-111-1--11-1111111111111111----------111111111111111----1----1------------1111----11111----------11---111-----1--11---1111111111111111111-11111-----111111--11111111-1----------111111111-----1111---1---11---------------1---1--1-1-1--1111111-11------------------------------1111111-1111111111111111-------11-111111111111-11------11111--1------------------------------------------------------11--------11-------------------1-1111--11111111-----------------------------1---11--1--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 87.9 SQ:SECSTR #################cHHHHHHHHTTccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEcTTcHHHHHHHHHHHHcccHHHHHHHHTTTTcTEEEEEcHHHHHHHHHHHHHTTcEEEEc DISOP:02AL 6-7, 12-14, 55-68| PSIPRED cEEEccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHccccEEEEEEccccccHHHHHHHHHHccccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHcccEEEEc //