[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rplS
DDBJ      :rplS         50S ribosomal protein L19
Swiss-Prot:RL19_RICCN   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  903/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->126 1vs6P PDBj 6e-31 61.3 %
:RPS:PDB   2->124 3bboR PDBj 7e-29 31.0 %
:RPS:SCOP  1->126 2j01T1  b.34.5.6 * 3e-32 43.8 %
:HMM:SCOP  6->128 2gyaN1 b.34.5.6 * 1.2e-33 55.3 %
:RPS:PFM   8->126 PF01245 * Ribosomal_L19 6e-24 58.2 %
:HMM:PFM   1->126 PF01245 * Ribosomal_L19 7.2e-47 60.7 112/113  
:BLT:SWISS 1->138 RL19_RICCN 6e-75 100.0 %
:PROS 99->114|PS01015|RIBOSOMAL_L19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02690.1 GT:GENE rplS GT:PRODUCT 50S ribosomal protein L19 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 152966..153382 GB:FROM 152966 GB:TO 153382 GB:DIRECTION + GB:GENE rplS GB:PRODUCT 50S ribosomal protein L19 GB:PROTEIN_ID AAL02690.1 GB:DB_XREF GI:15619197 GB:GENE:GENE rplS LENGTH 138 SQ:AASEQ MNIIDRFEQENISKRTANKKIPDFEAGDTVKVTVKIIDRSIEKDGKEKLTERFQAYEGVVIAKRNRGITSSFLVRKISHGEGVERRFMTYSPMVHSIDVVKYGVVRRAKLYYLRNRSGKSARIKERHIPIAKTKAAKA GT:EXON 1|1-138:0| SW:ID RL19_RICCN SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=RC0152; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->138|RL19_RICCN|6e-75|100.0|138/138| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 99->114|PS01015|RIBOSOMAL_L19|PDOC00778| BL:PDB:NREP 1 BL:PDB:REP 2->126|1vs6P|6e-31|61.3|111/114| RP:PDB:NREP 1 RP:PDB:REP 2->124|3bboR|7e-29|31.0|113/113| RP:PFM:NREP 1 RP:PFM:REP 8->126|PF01245|6e-24|58.2|110/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 1->126|PF01245|7.2e-47|60.7|112/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 1->126|2j01T1|3e-32|43.8|112/137|b.34.5.6| HM:SCP:REP 6->128|2gyaN1|1.2e-33|55.3|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 955 OP:NHOMOORG 927 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-11111111111111111-1111111111 ------1-----------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------1-112E122112252-31--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 91.3 SQ:SECSTR #cccccccTTHHHHTTcccccccccccccccccccccccc#####ccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTccccccccccccc###### DISOP:02AL 124-138| PSIPRED ccHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEcccccccEEEEEEEEcccEEEEEEEccccEEEEEEEEEEccEEHHHHHEEccccccEEEEEEcccccccHHHccc //