[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rplX
DDBJ      :rplX         50S ribosomal protein L24
Swiss-Prot:RL24_RICPU   RecName: Full=50S ribosomal protein L24;

Homologs  Archaea  0/68 : Bacteria  767/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->96 1vsaS PDBj 5e-18 44.2 %
:RPS:PDB   1->97 3bboW PDBj 9e-22 37.1 %
:RPS:SCOP  4->97 1vs6U1  b.34.5.1 * 1e-16 41.3 %
:HMM:SCOP  5->103 2gyaS1 b.34.5.1 * 2.9e-34 63.9 %
:HMM:PFM   8->38 PF00467 * KOW 1.4e-11 45.2 31/32  
:BLT:SWISS 1->97 RL24_RICPU 8e-45 100.0 %
:PROS 9->26|PS01108|RIBOSOMAL_L24
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03533.1 GT:GENE rplX GT:PRODUCT 50S ribosomal protein L24 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(928429..928758) GB:FROM 928429 GB:TO 928758 GB:DIRECTION - GB:GENE rplX GB:PRODUCT 50S ribosomal protein L24 GB:PROTEIN_ID AAL03533.1 GB:DB_XREF GI:15620109 GB:GENE:GENE rplX LENGTH 109 SQ:AASEQ MIKLKVKKGDEVVVITGKHKGKKGKILKVFPEDSKVIVSGVNVVKKHTKSNQMSEGGIITKELPIHISNIAHIDPKTGNPTKVAFKFLEDGSKVRVAKKSGEIIGKEGK GT:EXON 1|1-109:0| SW:ID RL24_RICPU SW:DE RecName: Full=50S ribosomal protein L24; SW:GN Name=rplX; OrderedLocusNames=RPR_06175; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->97|RL24_RICPU|8e-45|100.0|97/109| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 9->26|PS01108|RIBOSOMAL_L24|PDOC00852| SEG 17->25|gkhkgkkgk| SEG 98->108|kksgeiigkeg| BL:PDB:NREP 1 BL:PDB:REP 2->96|1vsaS|5e-18|44.2|95/103| RP:PDB:NREP 1 RP:PDB:REP 1->97|3bboW|9e-22|37.1|97/110| HM:PFM:NREP 1 HM:PFM:REP 8->38|PF00467|1.4e-11|45.2|31/32|KOW| RP:SCP:NREP 1 RP:SCP:REP 4->97|1vs6U1|1e-16|41.3|92/102|b.34.5.1| HM:SCP:REP 5->103|2gyaS1|2.9e-34|63.9|97/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 823 OP:NHOMOORG 797 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-1111111111111111111111111-1----11111111111-111111111111111111111----111111111--111111111-1---------------111111111111--111111111111111111111-1-111-11111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-1-11-1---1111111111111111111111-11111111111111111111111111-11111111111111111111111111111---1-111-1111111111111111111-1111111121111111111111111111111111111-1111111111111111111111111111111111111111111111111111111---11111--1111-11111111111111-11111111111111111111111111111111111111111111-11111111111-111111-------1111-1-1--111-1111111111111111-----1111-1-1111111-1-------11--1111111111111111111111111111111111-11111--111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111-1-----11111111111111111111111111-111111111111111111111111111111111111---1-----------11111111111111111----11--------1-11-----1-1--1------1-1-1111111111111--- 11--11--1----------------------------------------------------------------------------------------------------1------------------------------------------------1----1---------1111-1F121113332-2211-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 89.0 SQ:SECSTR TTcccccccccEEEcccccTTcccccccccccccccccccccccccccccccccccccccccccccGGGEEEccccccccccccccccccccccccc############ DISOP:02AL 1-3, 48-59, 106-109| PSIPRED ccccccccccEEEEEEccccccEEEEEEEEccccEEEEEccEEEEEEEcccccccccEEEEEcccccccEEEEEcccccccEEEEEEEEcccEEEEEcccccccccccc //