[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rpmI
DDBJ      :rpmI         50S ribosomal protein L35
Swiss-Prot:RL35_RICCN   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->86 2hgu7 PDBj 1e-09 42.2 %
:RPS:PDB   24->86 3bbo5 PDBj 2e-13 32.3 %
:RPS:SCOP  23->86 2hgj71  d.301.1.1 * 2e-14 41.3 %
:HMM:SCOP  23->87 2i2t31 d.301.1.1 * 9e-19 45.3 %
:RPS:PFM   23->81 PF01632 * Ribosomal_L35p 2e-05 44.1 %
:HMM:PFM   23->81 PF01632 * Ribosomal_L35p 1.1e-18 42.4 59/61  
:BLT:SWISS 22->89 RL35_RICCN 9e-36 100.0 %
:PROS 26->52|PS00936|RIBOSOMAL_L35

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03472.1 GT:GENE rpmI GT:PRODUCT 50S ribosomal protein L35 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 875905..876174 GB:FROM 875905 GB:TO 876174 GB:DIRECTION + GB:GENE rpmI GB:PRODUCT 50S ribosomal protein L35 GB:PROTEIN_ID AAL03472.1 GB:DB_XREF GI:15620044 GB:GENE:GENE rpmI LENGTH 89 SQ:AASEQ MALVCLMFYRLNLEIPIIRNNMPKLKTKSAVKKRFKLTASGKVIASQAGKKHFMRRRTKAQIRNLRGTTILCPQDRYNIKKYFLPYGIN GT:EXON 1|1-89:0| SW:ID RL35_RICCN SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=RC0934; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 22->89|RL35_RICCN|9e-36|100.0|68/68| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 26->52|PS00936|RIBOSOMAL_L35|PDOC00721| BL:PDB:NREP 1 BL:PDB:REP 22->86|2hgu7|1e-09|42.2|64/64| RP:PDB:NREP 1 RP:PDB:REP 24->86|3bbo5|2e-13|32.3|62/62| RP:PFM:NREP 1 RP:PFM:REP 23->81|PF01632|2e-05|44.1|59/61|Ribosomal_L35p| HM:PFM:NREP 1 HM:PFM:REP 23->81|PF01632|1.1e-18|42.4|59/61|Ribosomal_L35p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01632|IPR001706| GO:PFM GO:0005622|"GO:intracellular"|PF01632|IPR001706| GO:PFM GO:0005840|"GO:ribosome"|PF01632|IPR001706| GO:PFM GO:0006412|"GO:translation"|PF01632|IPR001706| RP:SCP:NREP 1 RP:SCP:REP 23->86|2hgj71|2e-14|41.3|63/63|d.301.1.1| HM:SCP:REP 23->87|2i2t31|9e-19|45.3|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 109 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------1-----1-----1-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------1111111111111111111111------------111111111111---1--1---11111-111111111111111111111111111--111111--1111111111111111111111111-----------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 73.0 SQ:SECSTR #####################cccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTcTTc### DISOP:02AL 50-69| PSIPRED cHHHHEEHHHHcccEEEEEcccccccccccccEEEEEcccccEEEcccccccccccccHHHHHHccccEEEcHHHHHHHHHHHcccccc //