[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rpmJ
DDBJ      :rpmJ         50S ribosomal protein L36
Swiss-Prot:RL36_RICRS   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->41 2i2t41 g.42.1.1 * 2.9e-10 57.9 %
:HMM:PFM   1->41 PF00444 * Ribosomal_L36 1.4e-19 57.9 38/38  
:BLT:SWISS 13->41 RL36_RICRS 5e-13 100.0 %
:PROS 14->40|PS00828|RIBOSOMAL_L36
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03220.1 GT:GENE rpmJ GT:PRODUCT 50S ribosomal protein L36 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(661579..661704) GB:FROM 661579 GB:TO 661704 GB:DIRECTION - GB:GENE rpmJ GB:PRODUCT 50S ribosomal protein L36 GB:PROTEIN_ID AAL03220.1 GB:DB_XREF GI:15619772 GB:GENE:GENE rpmJ LENGTH 41 SQ:AASEQ MKVVSSLKSLKKRDKDCQIVKRRGKIFVINKKNKRFKAKQG GT:EXON 1|1-41:0| SW:ID RL36_RICRS SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=A1G_04395; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 13->41|RL36_RICRS|5e-13|100.0|29/41| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 14->40|PS00828|RIBOSOMAL_L36|PDOC00650| SEG 2->12|kvvsslkslkk| HM:PFM:NREP 1 HM:PFM:REP 1->41|PF00444|1.4e-19|57.9|38/38|Ribosomal_L36| HM:SCP:REP 1->41|2i2t41|2.9e-10|57.9|38/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 35-41| PSIPRED ccHHHHHHHHHccccccEEEEccccEEEEEccccccccccc //