[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rpsD
DDBJ      :rpsD         30S ribosomal protein S4
Swiss-Prot:RS4_RICRS    RecName: Full=30S ribosomal protein S4;

Homologs  Archaea  0/68 : Bacteria  912/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->205 1fjgD PDBj 4e-41 47.4 %
:RPS:PDB   43->205 1c05A PDBj 2e-32 44.0 %
:RPS:SCOP  7->205 1fjgD  d.66.1.2 * 7e-38 45.4 %
:HMM:SCOP  2->205 1fjgD_ d.66.1.2 * 7.8e-58 41.8 %
:RPS:PFM   33->93 PF00163 * Ribosomal_S4 4e-09 51.7 %
:RPS:PFM   95->140 PF01479 * S4 5e-08 45.7 %
:HMM:PFM   6->93 PF00163 * Ribosomal_S4 2.1e-21 35.6 87/94  
:HMM:PFM   95->141 PF01479 * S4 8.1e-21 48.9 47/48  
:BLT:SWISS 1->205 RS4_RICRS e-116 100.0 %
:PROS 92->116|PS00632|RIBOSOMAL_S4

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03006.1 GT:GENE rpsD GT:PRODUCT 30S ribosomal protein S4 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(464512..465129) GB:FROM 464512 GB:TO 465129 GB:DIRECTION - GB:GENE rpsD GB:PRODUCT 30S ribosomal protein S4 GB:PROTEIN_ID AAL03006.1 GB:DB_XREF GI:15619541 GB:GENE:GENE rpsD LENGTH 205 SQ:AASEQ MTKIVRSKYKASRRLGVSLWGDSKDAFNTRNYRPGQHGQNTMIKTSDYGLHLKAKQRLKCHYGRVTEKQFRNIFALAQKMKGNTGENFIGLLESRLDTVVYRMNIAPTIFAARQLVSHGHIKLNGKKADIASIRLKAGDVIEVKESVKQIPLIQESVSKQGQTTPGYLSFDVPSLTGKYLRVPALSDVPYPFEAEVHLVIELYSR GT:EXON 1|1-205:0| SW:ID RS4_RICRS SW:DE RecName: Full=30S ribosomal protein S4; SW:GN Name=rpsD; OrderedLocusNames=A1G_02650; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|RS4_RICRS|e-116|100.0|205/205| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 92->116|PS00632|RIBOSOMAL_S4|PDOC00549| BL:PDB:NREP 1 BL:PDB:REP 13->205|1fjgD|4e-41|47.4|190/208| RP:PDB:NREP 1 RP:PDB:REP 43->205|1c05A|2e-32|44.0|159/159| RP:PFM:NREP 2 RP:PFM:REP 33->93|PF00163|4e-09|51.7|60/93|Ribosomal_S4| RP:PFM:REP 95->140|PF01479|5e-08|45.7|46/46|S4| HM:PFM:NREP 2 HM:PFM:REP 6->93|PF00163|2.1e-21|35.6|87/94|Ribosomal_S4| HM:PFM:REP 95->141|PF01479|8.1e-21|48.9|47/48|S4| GO:PFM:NREP 3 GO:PFM GO:0005622|"GO:intracellular"|PF00163|IPR001912| GO:PFM GO:0019843|"GO:rRNA binding"|PF00163|IPR001912| GO:PFM GO:0003723|"GO:RNA binding"|PF01479|IPR002942| RP:SCP:NREP 1 RP:SCP:REP 7->205|1fjgD|7e-38|45.4|196/208|d.66.1.2| HM:SCP:REP 2->205|1fjgD_|7.8e-58|41.8|201/208|d.66.1.2|1/1|Alpha-L RNA-binding motif| OP:NHOMO 961 OP:NHOMOORG 923 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111121111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111323122222221211122222211111211111111111111111111121111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122211111111121112121111111111111111111111111112211111111111111111111111111111111111111121111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 --------------1-------------------------------------------------------------------------------------1--112----------------------------------------------------1--------------1-1----------1-1--2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 99.5 SQ:SECSTR ccccccccTTccccccccccccccTGGGccccccccccccccccccHHHHHHHHHHHHHHTTT#ccHHHHHHHHHHHTTcccTHHHHHHHHHHHcHHHHHHHTTccccHHHHHHHHHTTcEEETTEEcccccccccTTcEEEEcGGGcccHHHHHHHHTcccccccEEEEETTTTEEEEcccccTTTccccccccHHHHHHHHHc DISOP:02AL 27-48, 149-161| PSIPRED ccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccEEEccEEEccccEEEccccEEEEccccccHHHHHHHHHHcccccccEEEEEHHHcEEEEEEcEEccccccccccccEEEEEEEcc //