[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : rpsP
DDBJ      :rpsP         30S ribosomal protein S16
Swiss-Prot:RS16_RICRS   RecName: Full=30S ribosomal protein S16;

Homologs  Archaea  0/68 : Bacteria  832/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
d.27.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->79 1vs7P PDBj 2e-17 52.6 %
:RPS:PDB   3->82 3bbnP PDBj 2e-25 41.3 %
:RPS:SCOP  3->82 1fjgP  d.27.1.1 * 8e-28 46.2 %
:HMM:SCOP  2->86 1fjgP_ d.27.1.1 * 2.2e-26 54.2 %
:RPS:PFM   9->70 PF00886 * Ribosomal_S16 7e-15 54.8 %
:HMM:PFM   9->70 PF00886 * Ribosomal_S16 4.8e-29 53.2 62/62  
:BLT:SWISS 1->111 RS16_RICRS 1e-51 100.0 %
:PROS 3->12|PS00732|RIBOSOMAL_S16
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03897.1 GT:GENE rpsP GT:PRODUCT 30S ribosomal protein S16 GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(1256703..1257038) GB:FROM 1256703 GB:TO 1257038 GB:DIRECTION - GB:GENE rpsP GB:PRODUCT 30S ribosomal protein S16 GB:PROTEIN_ID AAL03897.1 GB:DB_XREF GI:15620503 GB:GENE:GENE rpsP LENGTH 111 SQ:AASEQ MAVKIRLARGGAKKRPFYRVVVANATAPRDGDFLEKVGTYDPMLASDNSERVVLKKDRIEYWLGTGAKPTERVAKFIEQAGVTLPEKVKKEMEVKAKNRKARLSKKEAKEA GT:EXON 1|1-111:0| SW:ID RS16_RICRS SW:DE RecName: Full=30S ribosomal protein S16; SW:GN Name=rpsP; OrderedLocusNames=A1G_07460; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->111|RS16_RICRS|1e-51|100.0|111/111| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 3->12|PS00732|RIBOSOMAL_S16|PDOC00600| SEG 86->97|ekvkkemevkak| BL:PDB:NREP 1 BL:PDB:REP 3->79|1vs7P|2e-17|52.6|76/80| RP:PDB:NREP 1 RP:PDB:REP 3->82|3bbnP|2e-25|41.3|75/80| RP:PFM:NREP 1 RP:PFM:REP 9->70|PF00886|7e-15|54.8|62/62|Ribosomal_S16| HM:PFM:NREP 1 HM:PFM:REP 9->70|PF00886|4.8e-29|53.2|62/62|Ribosomal_S16| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00886|IPR000307| GO:PFM GO:0005622|"GO:intracellular"|PF00886|IPR000307| GO:PFM GO:0005840|"GO:ribosome"|PF00886|IPR000307| GO:PFM GO:0006412|"GO:translation"|PF00886|IPR000307| RP:SCP:NREP 1 RP:SCP:REP 3->82|1fjgP|8e-28|46.2|78/83|d.27.1.1| HM:SCP:REP 2->86|1fjgP_|2.2e-26|54.2|83/83|d.27.1.1|1/1|Ribosomal protein S16| OP:NHOMO 1021 OP:NHOMOORG 977 OP:PATTERN -------------------------------------------------------------------- 111111-1111111111----11111-----11111-11111111111-111111-1111111111111111111---11111--1111111111111111111-111-1111111111111111111111111-11111111111--------------------1----------------1111111-111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-1111111111111111111111111111-111-111111111111111121111111111111111111111111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111---1----111111-1111111111-1-1-111 ------1-----111-111111111111111111111111111111-11111111--1111111--11-111111-1-1111111111----11111111---112-1-111212-1-1--11111-11371-121-----111111---111111--1----2-1-111---122112F1112242221231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 94.6 SQ:SECSTR #cEEEcccccccTTccccccccEETTcccccccccccccccTTTcccTcccccccTTTccccTTcccEEcTTTccccTTTTc#HHHHccTTEEEEEETTEEEEEEcc#### DISOP:02AL 85-111| PSIPRED cEEEEEHHHcccccccEEEEEEEcccccccccccccccccccccccccccEEEEcHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccc //