[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : tlc3
DDBJ      :tlc3         ADP,ATP carrier protein
Swiss-Prot:TLCC_RICCN   RecName: Full=ADP,ATP carrier protein 3;AltName: Full=ADP/ATP translocase 3;

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
:501 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   225->354 2a6hD PDBj 4e-04 12.4 %
:RPS:PFM   18->496 PF03219 * TLC e-108 53.1 %
:HMM:PFM   5->496 PF03219 * TLC 3.2e-198 51.0 484/491  
:BLT:SWISS 1->501 TLCC_RICCN 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03260.1 GT:GENE tlc3 GT:PRODUCT ADP,ATP carrier protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 692126..693631 GB:FROM 692126 GB:TO 693631 GB:DIRECTION + GB:GENE tlc3 GB:PRODUCT ADP,ATP carrier protein GB:PROTEIN_ID AAL03260.1 GB:DB_XREF GI:15619815 GB:GENE:GENE tlc3 LENGTH 501 SQ:AASEQ MLPPKIFFEKVKEIMWPIERKELKLFIPMALMMLCILFNFGALRSIKDSLVVPSMGAEIISFLKLWLVLPSCVIFTVLYVKLSNNLNFEYIFYIIVGSFLLFFLLFAYIIYPNQDIYHPNDEMINKLIASYPNFKWFIKIGSQWSYALMYIFAELWSAVVINLMFWQFANHIFDTSKAKRFYPVLGMVGNIGLIIAGSVLVFFSSGQDVIDSELLPDSFNSSAGNAIMLQPIMSIIVTAGIIAMLLFRIINRFILTDSINVLDAKKVTAKMKTKLSVIESIKLVIHSKYIGRIALLIICYGLLINIVEGPWKAKIKELHPNTIDYVNFMGRFNIWMGISCVTFMIIGSNILRRLGWLISALLTPIMLSITGLMFFIFIIFIEEIGECFGDFNLLYAAIIVGAIQNILSKSSKYSLFDSTKEMAYIPLSLELRTKGKAAVEVIGTKFGKSLGAFIQSLIFIIIPTATFDSIIIYLLITFIVMMSLWIWNVIKLNKEYVELCK GT:EXON 1|1-501:0| SW:ID TLCC_RICCN SW:DE RecName: Full=ADP,ATP carrier protein 3;AltName: Full=ADP/ATP translocase 3; SW:GN Name=tlcC; Synonyms=tlc3; OrderedLocusNames=RC0722; SW:KW ATP-binding; Cell membrane; Complete proteome; Membrane;Nucleotide-binding; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->501|TLCC_RICCN|0.0|100.0|501/501| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 12 TM:REGION 22->44| TM:REGION 57->79| TM:REGION 89->111| TM:REGION 146->168| TM:REGION 185->207| TM:REGION 230->252| TM:REGION 288->310| TM:REGION 330->351| TM:REGION 365->387| TM:REGION 389->411| TM:REGION 439->461| TM:REGION 470->492| SEG 99->106|fllffllf| SEG 374->389|ffifiifieeigecfg| RP:PDB:NREP 1 RP:PDB:REP 225->354|2a6hD|4e-04|12.4|129/1381| RP:PFM:NREP 1 RP:PFM:REP 18->496|PF03219|e-108|53.1|469/477|TLC| HM:PFM:NREP 1 HM:PFM:REP 5->496|PF03219|3.2e-198|51.0|484/491|TLC| GO:PFM:NREP 4 GO:PFM GO:0005471|"GO:ATP:ADP antiporter activity"|PF03219|IPR004667| GO:PFM GO:0005524|"GO:ATP binding"|PF03219|IPR004667| GO:PFM GO:0006810|"GO:transport"|PF03219|IPR004667| GO:PFM GO:0016021|"GO:integral to membrane"|PF03219|IPR004667| OP:NHOMO 162 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------1-------------222222222222224--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------555555555555555-----------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------4-5-----------------------------------------------------------------113117111332242-2223----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 25.7 SQ:SECSTR ################################################################################################################################################################################################################################HcGGGTcccccccccHHHHHHHHTTcccccccccccccEEEEEccc#cccEEEEEEccccEEEEEEcTTccccccTTccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHTT################################################################################################################################################### DISOP:02AL 1-3, 260-280| PSIPRED cccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHccccHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHEEEEEHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccEEEcHHHHHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccHHHcccccEEEEEccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //