[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : tlyA
DDBJ      :tlyA         hemolysin
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  508/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.66.1d.66.1
:251 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   36->240 3hp7A PDBj 1e-31 40.2 %
:RPS:PDB   2->62 1dm9B PDBj 3e-06 31.0 %
:RPS:PDB   61->221 3douA PDBj 2e-08 20.7 %
:RPS:SCOP  1->63 1p9kA  d.66.1.6 * 3e-07 12.9 %
:RPS:SCOP  61->156 1eizA  c.66.1.2 * 1e-07 16.3 %
:HMM:SCOP  5->102 1c06A_ d.66.1.2 * 5.3e-15 30.6 %
:HMM:SCOP  60->248 1ej0A_ c.66.1.2 * 4.3e-23 26.5 %
:RPS:PFM   62->242 PF01728 * FtsJ 9e-08 39.1 %
:HMM:PFM   61->244 PF01728 * FtsJ 7.7e-24 23.9 155/181  
:HMM:PFM   5->31 PF01479 * S4 3.2e-05 40.7 27/48  
:HMM:PFM   29->55 PF09138 * Urm1 0.00069 30.8 26/96  
:BLT:SWISS 3->241 YQXC_BACSU 2e-35 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03360.1 GT:GENE tlyA GT:PRODUCT hemolysin GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(777005..777760) GB:FROM 777005 GB:TO 777760 GB:DIRECTION - GB:GENE tlyA GB:PRODUCT hemolysin GB:PROTEIN_ID AAL03360.1 GB:DB_XREF GI:15619922 GB:GENE:GENE tlyA LENGTH 251 SQ:AASEQ MTKIRLDEYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQVNINDTEIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGELHPKLRDNPHIKVLEKTNARYLTDKQIITKPDLIVCDASFISLTTILPTVLNLVKEDCMLIALIKPQFEVEKHEVEQGGVIKNPLLHQKVCDKIKDWLEKEHNFKIFGIIASPILGAKGNQEFLICGKRKTLIFL GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 3->241|YQXC_BACSU|2e-35|37.1|237/281| BL:PDB:NREP 1 BL:PDB:REP 36->240|3hp7A|1e-31|40.2|199/270| RP:PDB:NREP 2 RP:PDB:REP 2->62|1dm9B|3e-06|31.0|58/107| RP:PDB:REP 61->221|3douA|2e-08|20.7|150/170| RP:PFM:NREP 1 RP:PFM:REP 62->242|PF01728|9e-08|39.1|151/179|FtsJ| HM:PFM:NREP 3 HM:PFM:REP 61->244|PF01728|7.7e-24|23.9|155/181|FtsJ| HM:PFM:REP 5->31|PF01479|3.2e-05|40.7|27/48|S4| HM:PFM:REP 29->55|PF09138|0.00069|30.8|26/96|Urm1| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 2 RP:SCP:REP 1->63|1p9kA|3e-07|12.9|62/79|d.66.1.6| RP:SCP:REP 61->156|1eizA|1e-07|16.3|92/181|c.66.1.2| HM:SCP:REP 5->102|1c06A_|5.3e-15|30.6|98/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 60->248|1ej0A_|4.3e-23|26.5|170/0|c.66.1.2|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 533 OP:NHOMOORG 524 OP:PATTERN ------------------------------------------------1------------------- 1111111111111111111-11111111111111111111111111111111111111--1111111111111111111112111111------------------------------------------------11111---111111111111111111111111111111111111111---111111111111111111111111111111111111111111111111-------------------111111111-111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11-1-111111111111111111111111111111111-11111111111-11111111111111111----------1111111111111111------------1111111111111-----11111--------------------------------------11111111111-------11-----------11111111111111111111111111111111111111111111111111111111111-------1---------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------1111111111111111--1----1--111---111111-1-11111-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117111111111-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 95.6 SQ:SECSTR HccccHHHHHHHTTccccHHHHHHHHHTTcEETTTcEEccTTccccTTcEEEEEEETTEETTcHHHHHHHHHHHHHccccTTcEEEEEccTTcHHHHHHTTTccEEEEEEccccccTTcEEEEccTTcccHHHHHHHHHHHHTcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHEEEGHHHHHHHHHHEEEEEEEcTHHHHHHHHGGGEEEEEEEcEEEEEEcccccGGGcccEE########### PSIPRED ccHHHHHHHHHHccccccHHHHHHHHHcccEEEccEEEccccccccccccEEEEccccccccccHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccEEEEEEEccccccHHHHccccEEEEccccHHHccHHHccccccEEEEEcHHHHHHHHHHHHHHHHccccEEEEEEccHHcccHHHcccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEEccccccc //