[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : yhbH
DDBJ      :yhbH         probable sigma(54) modulation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  314/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.204.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->95 1n3gA PDBj 6e-06 26.4 %
:RPS:SCOP  1->105 1imuA  d.204.1.1 * 1e-21 20.8 %
:HMM:SCOP  1->111 1imuA_ d.204.1.1 * 5.5e-26 33.6 %
:RPS:PFM   3->98 PF02482 * Ribosomal_S30AE 8e-11 32.6 %
:HMM:PFM   3->99 PF02482 * Ribosomal_S30AE 5.3e-27 38.7 93/94  
:HMM:PFM   130->187 PF09084 * NMT1 0.00073 21.1 57/216  
:HMM:PFM   87->132 PF11467 * LEDGF 0.00087 31.7 41/106  
:BLT:SWISS 1->189 RP5M_BRAJA 3e-27 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL03172.1 GT:GENE yhbH GT:PRODUCT probable sigma(54) modulation protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 619333..619911 GB:FROM 619333 GB:TO 619911 GB:DIRECTION + GB:GENE yhbH GB:PRODUCT probable sigma(54) modulation protein GB:PROTEIN_ID AAL03172.1 GB:DB_XREF GI:15619720 GB:GENE:GENE yhbH LENGTH 192 SQ:AASEQ MIISVSGQHISIGNNLQEYSKERATQVVKKYFTDIINIDIHFSKEGINFKCDIIVKYGSGKHNIVKSNDSCSDIYVAFDKAMSKLEKQLRKYKSKFKNHHAGKVKISEIAYEGTKYIINPQSDSETSNAEDNDNPAIIAEKPVEILKLSVKEAVMQMDLEDLPVVVFKNINNDRINIVYYRKDGNISWVDYN GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 1->189|RP5M_BRAJA|3e-27|32.1|187/203| BL:PDB:NREP 1 BL:PDB:REP 1->95|1n3gA|6e-06|26.4|91/113| RP:PFM:NREP 1 RP:PFM:REP 3->98|PF02482|8e-11|32.6|92/98|Ribosomal_S30AE| HM:PFM:NREP 3 HM:PFM:REP 3->99|PF02482|5.3e-27|38.7|93/94|Ribosomal_S30AE| HM:PFM:REP 130->187|PF09084|0.00073|21.1|57/216|NMT1| HM:PFM:REP 87->132|PF11467|0.00087|31.7|41/106|LEDGF| GO:PFM:NREP 2 GO:PFM GO:0005488|"GO:binding"|PF02482|IPR003489| GO:PFM GO:0044238|"GO:primary metabolic process"|PF02482|IPR003489| RP:SCP:NREP 1 RP:SCP:REP 1->105|1imuA|1e-21|20.8|101/107|d.204.1.1| HM:SCP:REP 1->111|1imuA_|5.5e-26|33.6|107/107|d.204.1.1|1/1|Ribosome binding protein Y (YfiA homologue)| OP:NHOMO 317 OP:NHOMOORG 316 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1--11-----------------------------------------1---------------------11111111111------11-----11-11111-1--111111---1-111111-11-111--111111111-1111111111111-1-111111111111111--1-111111-11-11111111-11111111111--11--11111111111111111111111111111-111-1-11111111111111-111111111-1-1-1-11111-11111111-1----1111-------1111111111111111111111-1111111-111-11111111111111111111111111111111111111-1-1----1111111111111111111111-----1111----------------------------------------------------1------------------1-----1----111111111111111-11--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--1-111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 52.6 SQ:SECSTR cccEEccccccccHHHHHHHHHHHHHHGTTccccccEEEEEEEEETTEEEEEEEEEETTETccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccc########################################################################################### DISOP:02AL 97-108| PSIPRED cEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHccccccccccccccccccccEEEEEEEccccccHHHHHHHHHHccccEEEEEEcccccEEEEEEEEcccEEEEEcc //