[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : yqiY
DDBJ      :yqiY         amino acid ABC transporter permease protein
Swiss-Prot:GLNP_RICCN   RecName: Full=Putative glutamine transport system permease protein glnP;

Homologs  Archaea  30/68 : Bacteria  698/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->152 3dhwA PDBj 5e-08 23.5 %
:RPS:PDB   115->152 3dhwA PDBj 7e-08 35.3 %
:RPS:SCOP  15->215 2r6gG1  f.58.1.1 * 5e-24 13.4 %
:RPS:PFM   36->213 PF00528 * BPD_transp_1 3e-06 26.3 %
:HMM:PFM   33->215 PF00528 * BPD_transp_1 3e-28 18.4 179/185  
:BLT:SWISS 1->218 GLNP_RICCN e-119 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02709.1 GT:GENE yqiY GT:PRODUCT amino acid ABC transporter permease protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION 170563..171219 GB:FROM 170563 GB:TO 171219 GB:DIRECTION + GB:GENE yqiY GB:PRODUCT amino acid ABC transporter permease protein GB:PROTEIN_ID AAL02709.1 GB:DB_XREF GI:15619217 GB:GENE:GENE yqiY LENGTH 218 SQ:AASEQ MFEYLIKFYPKIFFIVEGTLVTLKYSVIAVIFGLVIGMLLAICKVNKNRALRLFANFYTSIFRGTPLLIQLSIIYFASPYIIGIKFSVFMAGAIAFSLNSGAYVSEVIRAGINAVDKGQFEAAEALAIPKFLITKDIILPQAVKNIFPSLVNELVNLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN GT:EXON 1|1-218:0| SW:ID GLNP_RICCN SW:DE RecName: Full=Putative glutamine transport system permease protein glnP; SW:GN Name=glnP; OrderedLocusNames=RC0171; SW:KW Amino-acid transport; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->218|GLNP_RICCN|e-119|100.0|218/218| GO:SWS:NREP 6 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 16->38| TM:REGION 67->89| TM:REGION 191->212| BL:PDB:NREP 1 BL:PDB:REP 12->152|3dhwA|5e-08|23.5|136/203| RP:PDB:NREP 1 RP:PDB:REP 115->152|3dhwA|7e-08|35.3|34/203| RP:PFM:NREP 1 RP:PFM:REP 36->213|PF00528|3e-06|26.3|175/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 33->215|PF00528|3e-28|18.4|179/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 15->215|2r6gG1|5e-24|13.4|201/284|f.58.1.1| OP:NHOMO 4632 OP:NHOMOORG 732 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----6--1C------766635C914225283533-769135--2121577B5A4755576631421---------------------------11111111111111-----1--4---222441111-22342233322---11--1--3322-1222--1222-1341111--27455555875566556623398556333854355555396222222222222222222246657AB885676666B93757D533388886665AA999888999986666566666666798BA98888135575645455232344423333122142331AA-4132-1111111171--11127444422M67222412222375347567R-22G22E29EK23rUUQVXVVVhMNOA---36K666845D1111111134511-39----------111111111111111--1-4--11-5HFBHNMMLOKC9CCDFFJUEDEEADHHc779412A8C958549AGGNQ244----A44422222---24-11K-997C56CAAA42-23-3-------1--5-4441555553343333333-13----9AC-3-----C-1111--11111111-11-3---1--------ABMM8CDAAAAAA8AA9-AACAAAAAAAAAA9AA99BJQHON776A8A7AAAAAAAAAA8AG998999931ECCCCCBBCCCC--5-222221111--7AE55553533323333266666-64554-GEEGHPJS9GICE5MJK----------667A99999AA97711---------------2----------------3515----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------6-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 62.8 SQ:SECSTR ###########cHHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHTTcccccH#HHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHH###HHHHHH################################################################## DISOP:02AL 218-219| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //