[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06899.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  84/915 : Eukaryota  55/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->110 2oigA PDBj 2e-10 30.9 %
:RPS:PDB   11->115 2a3qB PDBj 2e-18 35.6 %
:RPS:SCOP  16->118 2a3qA1  a.204.1.2 * 7e-17 35.9 %
:HMM:SCOP  8->118 1oglA_ a.204.1.1 * 1.4e-33 43.9 %
:RPS:PFM   41->114 PF03819 * MazG 1e-06 38.7 %
:HMM:PFM   38->109 PF03819 * MazG 1.7e-06 26.7 60/74  
:BLT:SWISS 17->116 DCTP1_HUMAN 1e-13 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06899.1 GT:GENE ABF06899.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 17396..17752 GB:FROM 17396 GB:TO 17752 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF06899.1 GB:DB_XREF GI:93352810 LENGTH 118 SQ:AASEQ MPVSDIHIAFTMALIDISNLQQAAAAFGEARGWGKYHSPKNLAMALSVEVAELVEIFQWQTEEESRGIMSTDERAHVEQELADITIYLTQLVTALGVDLDAAVQAKMEMNARKYPAPK GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 17->116|DCTP1_HUMAN|1e-13|36.4|99/170| BL:PDB:NREP 1 BL:PDB:REP 17->110|2oigA|2e-10|30.9|94/104| RP:PDB:NREP 1 RP:PDB:REP 11->115|2a3qB|2e-18|35.6|104/108| RP:PFM:NREP 1 RP:PFM:REP 41->114|PF03819|1e-06|38.7|62/67|MazG| HM:PFM:NREP 1 HM:PFM:REP 38->109|PF03819|1.7e-06|26.7|60/74|MazG| RP:SCP:NREP 1 RP:SCP:REP 16->118|2a3qA1|7e-17|35.9|103/113|a.204.1.2| HM:SCP:REP 8->118|1oglA_|1.4e-33|43.9|107/270|a.204.1.1|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 161 OP:NHOMOORG 144 OP:PATTERN -----------------------11---------------------------------111------- ----1-----1---------------------------------------1-----1-------111111--11111-------------------------------------------------------------------1-----------------------------------------------1-----------------1-------1----------------------------------1------1---1--------------------------------------------------------------1-------1-1----------1--------------------------1----------------------------------------------------------------------------------------------------------------------------11111-------------11---------1111-----1--11-1111-11-11111------------1-----1---------------1-----------1---------------------1---------1------------1---------------111------------------------------------------------------------------------------------------------------1--11-------------------------1-1111121111112-111-------------1---------------------------------------------------------------------------------1- --------------------------------------------------1-1------------------------------------------------------12121111111--111112-1-111-1111-1-1-111-11--1--1---11----11--------2---113-----2225-12--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 91.5 SQ:SECSTR #########cccccccHHHHHHHHHHHHHTccHHHHHcHHHHHHHHHHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHcccc# DISOP:02AL 1-2,65-72,116-119| PSIPRED cccccEEEEccHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccc //