[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06905.1
DDBJ      :             beta-lactamase-like protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:257 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   23->162 1vmeB PDBj 2e-04 28.2 %
:RPS:PDB   22->220 2bfkA PDBj 2e-17 18.1 %
:RPS:SCOP  25->234 1vmeA2  d.157.1.3 * 4e-36 23.5 %
:HMM:SCOP  28->242 1e5dA2 d.157.1.3 * 4.2e-34 21.5 %
:RPS:PFM   28->160 PF00753 * Lactamase_B 4e-05 28.2 %
:HMM:PFM   24->218 PF00753 * Lactamase_B 1.5e-25 23.7 186/194  
:BLT:SWISS 28->219 Y732_METJA 3e-09 27.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06905.1 GT:GENE ABF06905.1 GT:PRODUCT beta-lactamase-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 22853..23626 GB:FROM 22853 GB:TO 23626 GB:DIRECTION + GB:PRODUCT beta-lactamase-like protein GB:PROTEIN_ID ABF06905.1 GB:DB_XREF GI:93352816 InterPro:IPR001279 LENGTH 257 SQ:AASEQ MLYEAGGHVCLAFTDLVDEGQGEVVQSNQFLVVDNGHAALIDPGGNMTYSELYLTISRYFPPKQLDYVLASHADPDIVASVGRWLTSSDSRVLISQVWARFLPHFCQAGKTAGRIVTIPDGGMVIPLGNCQLIAVPAHFLHSEGNFQFYDPVSKILFSGDLGATMTSGTEAGTVVTDFDAHARRMLAFHRRYMSGNRACRLWAAMARTMDIEWIVPQHGPSFRGREMVNRFIDWIDQLQCGLDLLEPAHYRVPSMLG GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 28->219|Y732_METJA|3e-09|27.1|181/393| BL:PDB:NREP 1 BL:PDB:REP 23->162|1vmeB|2e-04|28.2|131/393| RP:PDB:NREP 1 RP:PDB:REP 22->220|2bfkA|2e-17|18.1|177/220| RP:PFM:NREP 1 RP:PFM:REP 28->160|PF00753|4e-05|28.2|131/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 24->218|PF00753|1.5e-25|23.7|186/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 25->234|1vmeA2|4e-36|23.5|196/250|d.157.1.3| HM:SCP:REP 28->242|1e5dA2|4.2e-34|21.5|209/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 82 OP:NHOMOORG 75 OP:PATTERN ------11-------11-------------------------------------111-11-------- -----------------------------------------------------------------------------------11211-----------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-------------11------------------------------------------------------------------------2-------------------------------------------------------------------1-1--1111-1111----11----2--------------22-1----------------2---------1-----------------------1-1-111----1------1-----------1----11------1--------------------------------------------------------------------------------------------1----------12-----------------111111-----11111----1------------------------------11--------------------------------1---------------------------1-1111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 99.2 SQ:SECSTR EEEEEEEEEGGEEEEEEEcTTccEEEEEEEEEEETTEEEEEcccccHHHHHHHHHHHHHHHTccEEEEEcccccHHHHTTHHHHHHHTTcEEEccHHHHHHHHHTccccTTccccccccccEEEEEETTEEEEEEcccccccccccEEEETTTTEEEEETTcccTTccTTcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccTHHHHHHHHHHHHHHHHHHTTcEEEEcHHHH## PSIPRED ccccccccEEEEEcccccccccccEEEEEEEEEEccEEEEEEccccHHHHHHHHHHHHHccHHHccEEEEccccHHHHccHHHHHHHccccEEEcHHHHHHHHHHHHccccccccEEEcccccEEEEccEEEEEEEcccccccccEEEEEccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHcccccHHHHcHHccccccccc //