[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06909.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  268/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:409 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->347 1pw4A  f.38.1.1 * 2e-10 16.8 %
:HMM:SCOP  1->408 1pw4A_ f.38.1.1 * 3.2e-63 28.0 %
:RPS:PFM   34->349 PF07690 * MFS_1 2e-12 29.0 %
:HMM:PFM   30->261 PF07690 * MFS_1 2.7e-30 25.1 231/353  
:HMM:PFM   232->403 PF07690 * MFS_1 1.2e-19 26.3 171/353  
:BLT:SWISS 22->352 FSR_ECOLI 1e-89 54.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06909.1 GT:GENE ABF06909.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 27028..28257 GB:FROM 27028 GB:TO 28257 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:PROTEIN_ID ABF06909.1 GB:DB_XREF GI:93352820 InterPro:IPR007114 InterPro:IPR011701 LENGTH 409 SQ:AASEQ MRPRTMSTTINPAHPADREEGTRFRVLYAISFAHFLNDMIQSLILAIYPMLKGGFNLSFTQIGLLTLTYQVTASLLQPVVGLYTDKHPKPHSLAIGMGFTLCGLLLLSVAPTYGVLLVAAALVGTGSSIFHPESSRVARLASGGQHGLAQSIFQVGGNGGSAMGPLLAAWIVHSQGSVAWFSLAALLAITVLWQIGGWYGRHLAERAAKKKGAGVVVNKLPKSTVVRAIVVLLLLIFSKYFYMASLNTYYTFYLMEKFGLARQTSQIYLFLFLFAVAAGTIMGGPIGDRIGRKRVIWASILGVAPFTLMLPHANLFWTAVLSVVIGFILASAFSAILVFAQELIPGKVGMVSGLFFGFAFGMGGIGAAVLGRLADAHGIETVYQLCAFLPLLGLLAVFLPDLRERAKAA GT:EXON 1|1-409:0| BL:SWS:NREP 1 BL:SWS:REP 22->352|FSR_ECOLI|1e-89|54.4|329/406| TM:NTM 10 TM:REGION 26->48| TM:REGION 99->121| TM:REGION 150->172| TM:REGION 177->199| TM:REGION 221->243| TM:REGION 266->288| TM:REGION 295->317| TM:REGION 319->341| TM:REGION 350->372| TM:REGION 382->403| SEG 207->217|aakkkgagvvv| SEG 225->236|vvraivvlllli| SEG 353->368|glffgfafgmggigaa| SEG 385->402|lcaflpllgllavflpdl| RP:PFM:NREP 1 RP:PFM:REP 34->349|PF07690|2e-12|29.0|314/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 30->261|PF07690|2.7e-30|25.1|231/353|MFS_1| HM:PFM:REP 232->403|PF07690|1.2e-19|26.3|171/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 2->347|1pw4A|2e-10|16.8|345/434|f.38.1.1| HM:SCP:REP 1->408|1pw4A_|3.2e-63|28.0|404/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 300 OP:NHOMOORG 270 OP:PATTERN --------------------------------------------1--2-------------------- -11----------------------------------111-----------1--------------11-1------------1-----111--2------111--111-1--------------------------1-------11-------------------------------------111-----111111111111111111----2111111-1---------22------------------------------------------------------------------------------------------------------1-1--11---------1----113-1---11-------1-----------1-1--1111111111111111111-1121111--1--111-112111111------311-1-----------1---1-----------------------------------1--111-21111111222211112221111111111--111-1111211----------1----------------2-1---1------1-1-1----------11111-------------------1--22111----------------------------------------1----111111111111-11111111-11111111111111111-11111111111111111-2-1111--11111111-112----------------1------1---------11111-1---------1111-222111-1------------------------11---------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21,204-214,405-410| PSIPRED cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //