[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06923.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->40 PF10969 * DUF2771 0.00059 24.2 33/161  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06923.1 GT:GENE ABF06923.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(39303..39551) GB:FROM 39303 GB:TO 39551 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF06923.1 GB:DB_XREF GI:93352834 LENGTH 82 SQ:AASEQ MSTSEFLRPEQRNEQVDEERSGQAGAKQVSPFHYCPLLSAAGLESAAAASPLPRLAGGLAPSAAHRASSAPVNAPKASNTRK GT:EXON 1|1-82:0| SEG 36->71|pllsaaglesaaaasplprlagglapsaahrassap| HM:PFM:NREP 1 HM:PFM:REP 8->40|PF10969|0.00059|24.2|33/161|DUF2771| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-27,65-83| PSIPRED ccHHHHccHHHHHHHHHHHHccHHHHHHcccccccccHHHcccHHHHcccccHHHHHccccHHHHccccccccccccccccc //