[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06936.1
DDBJ      :             aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
Swiss-Prot:GATC_RALME   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C;         Short=Asp/Glu-ADT subunit C;         EC=6.3.5.-;

Homologs  Archaea  1/68 : Bacteria  242/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.137.12
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->98 2g5hC PDBj 5e-09 33.0 %
:RPS:PDB   6->99 2dqnC PDBj 3e-24 32.2 %
:RPS:SCOP  7->99 2df4C1  a.137.12.1 * 4e-24 32.6 %
:HMM:SCOP  2->97 2f2aC1 a.137.12.1 * 4.7e-27 49.4 %
:RPS:PFM   20->94 PF02686 * Glu-tRNAGln 2e-09 49.3 %
:HMM:PFM   20->94 PF02686 * Glu-tRNAGln 2.1e-24 49.3 71/72  
:BLT:SWISS 1->99 GATC_RALME 2e-51 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06936.1 GT:GENE ABF06936.1 GT:PRODUCT aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(57222..57521) GB:FROM 57222 GB:TO 57521 GB:DIRECTION - GB:PRODUCT aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C GB:PROTEIN_ID ABF06936.1 GB:DB_XREF GI:93352847 InterPro:IPR003837 LENGTH 99 SQ:AASEQ MALALSDVKRIAHLARIETSDAEAEQTLAQLNNFFSLVEQMQAVDTTGIEPLAHPLSAVRDIAQRLREDAVTESDRRADYQRPAPATENGLYLVPKVIE GT:EXON 1|1-99:0| SW:ID GATC_RALME SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C; EC=6.3.5.-; SW:GN Name=gatC; OrderedLocusNames=Rmet_0050; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|GATC_RALME|2e-51|100.0|99/99| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 7->98|2g5hC|5e-09|33.0|88/99| RP:PDB:NREP 1 RP:PDB:REP 6->99|2dqnC|3e-24|32.2|90/98| RP:PFM:NREP 1 RP:PFM:REP 20->94|PF02686|2e-09|49.3|71/72|Glu-tRNAGln| HM:PFM:NREP 1 HM:PFM:REP 20->94|PF02686|2.1e-24|49.3|71/72|Glu-tRNAGln| GO:PFM:NREP 1 GO:PFM GO:0006450|"GO:regulation of translational fidelity"|PF02686|IPR003837| RP:SCP:NREP 1 RP:SCP:REP 7->99|2df4C1|4e-24|32.6|89/99|a.137.12.1| HM:SCP:REP 2->97|2f2aC1|4.7e-27|49.4|89/0|a.137.12.1|1/1|Glu-tRNAGln amidotransferase C subunit| OP:NHOMO 243 OP:NHOMOORG 243 OP:PATTERN ------------------------------------------------1------------------- 1------1-------------------------------------------------------------------------------------------------1--------------------1-1-1----1----1-----1---------------------------1-----1------------1----------------1-------1----11111111111--------------------------1-----------1---------------------------------------------------------------------------------1---------1-111---1---111-11111111111111111111111111111-11111111111111-111111111111111111111---11111111-111--11-----------------------------1111-111111111111111111111111111111111111111111111111111111111111111111111-11---1------1-----------------1----------------------------11----11---------------------------1111---------------------------------------------------------------------------------------------11111----11111---------------11111111111111111111111111111---------1----------------------------111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 94.9 SQ:SECSTR #####HHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHGGGGGcccTTccccccccccccccccccccccccccccHHHHHTTcccccccccccccccc DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccccccccccccccccccHHHHHHHcHHHcccEEEcccccc //