[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06945.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->74 PF11142 * DUF2917 4e-08 49.2 %
:HMM:PFM   9->72 PF11142 * DUF2917 1.6e-25 60.7 61/63  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06945.1 GT:GENE ABF06945.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 67773..68141 GB:FROM 67773 GB:TO 68141 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF06945.1 GB:DB_XREF GI:93352856 LENGTH 122 SQ:AASEQ MKALLTTTVFTLAPGEVTALSLHAAQRLFVEDAKGMDVWVTRENDSEDYWLRCGSSLMLRRGDEIVLSVDPRAAGTVRLALIAEARRPALTLADVPHIAYRAVRRLVRGTEWTPAEDKITAS GT:EXON 1|1-122:0| RP:PFM:NREP 1 RP:PFM:REP 9->74|PF11142|4e-08|49.2|63/65|DUF2917| HM:PFM:NREP 1 HM:PFM:REP 9->72|PF11142|1.6e-25|60.7|61/63|DUF2917| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1-1-1111---1111--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,116-123| PSIPRED ccEEEEEEEEEEccccEEEEEEccccEEEEEEccccEEEEEEccccHHcEEccccEEEEccccEEEEEEccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHEEcccccccccccccc //