[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06949.1
DDBJ      :             Allophanate hydrolase subunit 2
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  434/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
:339 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->300 PF02626 * AHS2 5e-62 55.1 %
:HMM:PFM   23->300 PF02626 * AHS2 6.7e-104 48.9 272/272  
:BLT:SWISS 1->321 YBGK_ECOLI 8e-80 52.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06949.1 GT:GENE ABF06949.1 GT:PRODUCT Allophanate hydrolase subunit 2 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 71065..72084 GB:FROM 71065 GB:TO 72084 GB:DIRECTION + GB:PRODUCT Allophanate hydrolase subunit 2 GB:PROTEIN_ID ABF06949.1 GB:DB_XREF GI:93352860 InterPro:IPR003778 LENGTH 339 SQ:AASEQ MIEIIRPGAQASVQDLGRVGFRRFGVGRSGAADDLALRVGNRLLGNDPGAAAIEFTLGRAAVRFEADMRVALTGAECSANLDGVPVWSWHAFDVRRGETLTLPSPRGGTRTYLCVAGGIDVPLVMNSRSTDLKSGFGGFEGRVLREGDRLPVGRPGIEQGQDWVGVAAPGWALPGQDGGNAIAIRLLPGPEYADFEPASQAALWQSEWTITPQSNRMGLRLQGPALARRAERSADLLSHGVVPGVMQVPPSGQPIALMSDAQTTGGYPKIGTVIGADLWRLAQVPLGATVRFRQVTLEEAAAAQAEVDRYLRQIDQALAWQRDGMQIAARRRATTRFVA GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 1->321|YBGK_ECOLI|8e-80|52.8|305/310| SEG 17->28|grvgfrrfgvgr| SEG 328->336|aarrrattr| RP:PFM:NREP 1 RP:PFM:REP 29->300|PF02626|5e-62|55.1|265/271|AHS2| HM:PFM:NREP 1 HM:PFM:REP 23->300|PF02626|6.7e-104|48.9|272/272|AHS2| OP:NHOMO 685 OP:NHOMOORG 495 OP:PATTERN ------------------------------------------------------1111111------- --2-21-21111-121111-11111211111112222465111-2111-21-322112--11211112111--------11----------------------11-------------------------------111-----11---1----------------1----------------11-11---2-1111-1111111111111111111111111--------1222222222222222222222-------1-------------1-------------------------------------------------1--1-----------111---------1--1-----1--11-111-11----111------1231211122212------------22122222--1-5224222432--2211-112111112121222222111111-1-----------------------------1-1---221121223312222222212222112321321--112--1--21-223--11--11----1111221-11--1-1-----------------------11-1-----11111-----------11------211211-1111111-------1----12-----11------1235-121111111111-11111111111111111111214311111111111111111112111---1--111111111111---1---------11-11-------111--11-22222111-11233331224322221443111-11111111111111111111--1--------------------------------------------------------------------1- ---------------1-11111121-1----------------111---21222111-----211111111121111--1111111---111-----11-1---------------------------------------------------------------------------11-----11----1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 339-340| PSIPRED cEEEEcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEEccEEEEEcccEEEEEEcccccEEEccEEcccccEEEEccccEEEEcccccccEEEEEEEcccccHHHHcHHHHHHHHHcccccccccccccEEEcccccccccccccccccccccccccccccEEEEEEEEccccccccHHHHHHHHHccEEEcccccEEEEEEEcccccccccccccccccccEEEEEEEcccccEEEEcccccccccccEEEEEEHHHHcHHHccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccc //