[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06962.1
DDBJ      :             RfaE bifunctional protein, domain II
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  394/915 : Eukaryota  2/199 : Viruses  1/175   --->[See Alignment]
c.26.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->130 3glvA PDBj 2e-09 33.0 %
:RPS:PDB   31->156 3do8A PDBj 2e-15 15.1 %
:RPS:SCOP  31->160 1cozA  c.26.1.2 * 3e-14 25.4 %
:HMM:SCOP  28->160 1cozA_ c.26.1.2 * 2.2e-22 33.6 %
:RPS:PFM   35->67 PF01467 * CTP_transf_2 3e-05 54.5 %
:HMM:PFM   33->156 PF01467 * CTP_transf_2 7e-19 30.8 120/157  
:BLT:SWISS 30->161 HLDE_PSEA7 8e-31 48.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06962.1 GT:GENE ABF06962.1 GT:PRODUCT RfaE bifunctional protein, domain II GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(83133..83624) GB:FROM 83133 GB:TO 83624 GB:DIRECTION - GB:PRODUCT RfaE bifunctional protein, domain II GB:PROTEIN_ID ABF06962.1 GB:DB_XREF GI:93352873 InterPro:IPR004820 InterPro:IPR004821 InterPro:IPR011914 LENGTH 163 SQ:AASEQ MNAPAFESKLVPADDVAALHAAVAKLPRPLVFTNGVFDILHRGHATYLAQARAMGASLVVGVNSDASVKMLGKGNDRPLNHDADRMALLAALASVDLVAMFREKTPVELIRLVRPDVYVKGGDYDIDTLEETRLVRSWGGQAYAIQFLHDRSTTKLLTKVRGG GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 30->161|HLDE_PSEA7|8e-31|48.9|131/474| SEG 10->27|lvpaddvaalhaavaklp| SEG 87->93|allaala| BL:PDB:NREP 1 BL:PDB:REP 31->130|3glvA|2e-09|33.0|97/122| RP:PDB:NREP 1 RP:PDB:REP 31->156|3do8A|2e-15|15.1|126/135| RP:PFM:NREP 1 RP:PFM:REP 35->67|PF01467|3e-05|54.5|33/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 33->156|PF01467|7e-19|30.8|120/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 31->160|1cozA|3e-14|25.4|122/126|c.26.1.2| HM:SCP:REP 28->160|1cozA_|2.2e-22|33.6|125/126|c.26.1.2|1/1|Nucleotidylyl transferase| OP:NHOMO 421 OP:NHOMOORG 402 OP:PATTERN -----------------------------------1-1------------1-----1--1-------- 121-------------1-------------------1----2-------21-222-----22--111-1-------------111111-----------------111----------------111111111111111-----11--11-----11------1-11---1-----------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1111-1111-----1121111111112---------------------11-------------11-1-----------1111111111111111-----------------------------1-----11111111111111111111111111111111111111-1----111----11111111111111--1111121--111112111111111111111111--11111-1111111111111111111-11111-1----111111111111111111111--1111-------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111122222----11111111111111111111----------1111111111111111111---------11111-111111111----------------21111111----------------------------------------------111 -----------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 83.4 SQ:SECSTR ###########################cEEEEEEEccccccHHHHHHHHHHHHHHTTcEEEEEEcHHHHHHHccccccHHHHHHHHHHHHHHHHccccEEEEEccTTTTTTTccccEEEEcTTTHHHHHHHHHHHHHHTccccEEEccccccccccHHTcHHT DISOP:02AL 1-4,163-164| PSIPRED cccccHHcccccHHHHHHHHHHHHHccccEEEEccEEccccHHHHHHHHHHHHHccEEEEEEccHHHHHHHccccccccccHHHHHHHHHHHHHccEEEEcccccHHHHHHHHcccEEEEcccccccHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHcc //