[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06967.1
DDBJ      :             fumarylacetoacetate (FAA) hydrolase
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  191/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->307 2dfuA PDBj 7e-37 17.1 %
:RPS:SCOP  102->345 1hyoA2  d.177.1.1 * 1e-49 24.2 %
:HMM:SCOP  97->347 1hyoA2 d.177.1.1 * 1.1e-60 26.6 %
:RPS:PFM   102->327 PF01557 * FAA_hydrolase 9e-19 39.1 %
:HMM:PFM   102->344 PF01557 * FAA_hydrolase 1.9e-37 32.4 207/217  
:BLT:SWISS 103->293 Y2225_ARCFU 5e-08 27.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06967.1 GT:GENE ABF06967.1 GT:PRODUCT fumarylacetoacetate (FAA) hydrolase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(88108..89148) GB:FROM 88108 GB:TO 89148 GB:DIRECTION - GB:PRODUCT fumarylacetoacetate (FAA) hydrolase GB:PROTEIN_ID ABF06967.1 GB:DB_XREF GI:93352878 InterPro:IPR002529 LENGTH 346 SQ:AASEQ MRPRRSGRLWPIRFAYVRLRMKLATLKDGSRDGQLVVVSRDLKTAHFATDIAGKLQTVLDDWAFYAPQLQDLYDALNAGRSRHPFPFQTKDCMAPLPRAYQWADGSAYVNHVELVRKARGAEMPPEFWTDPLMYQGGSDDFIGPQDDIVCASEAFGIDFEAEVAVITGDVRMGATPDQAGEAIRLVMLANDVSLRNLIPAELGKGFGFFQSKPATAFSPVAVTPDELGDAWRERRVHRPMVVHWNSKKVGSPDCGTDMVFDFGQLIAHICRTRNVRAGSIVGSGTISNVDRSKGYCCIAEKRMIETIDGGKPETEFMKYGDAVRIEMFDAEHKSIFGAIDQVVAAP GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 103->293|Y2225_ARCFU|5e-08|27.8|169/250| RP:PDB:NREP 1 RP:PDB:REP 42->307|2dfuA|7e-37|17.1|234/251| RP:PFM:NREP 1 RP:PFM:REP 102->327|PF01557|9e-19|39.1|192/213|FAA_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 102->344|PF01557|1.9e-37|32.4|207/217|FAA_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01557|IPR002529| GO:PFM GO:0008152|"GO:metabolic process"|PF01557|IPR002529| RP:SCP:NREP 1 RP:SCP:REP 102->345|1hyoA2|1e-49|24.2|244/298|d.177.1.1| HM:SCP:REP 97->347|1hyoA2|1.1e-60|26.6|248/0|d.177.1.1|1/1|FAH| OP:NHOMO 225 OP:NHOMOORG 204 OP:PATTERN -------11111111--------1-------1-----------------------------1------ --------------11111-1---1111111-------1---------1-------------2-----1-------------1---------------------11---1-----------------------------12---11------------------------------------------------111111111111111------111-------------1------------------------------------------------------------------------------------------------------------------------------------------------2111-------123---1------------------1--1--11--2--111111111-2211-1----------------------1-------------------------------13-1------2111111111111111111111231111--11111111111112--1----1-----------11-11----------------------111113-1---------------------------11-1--111--1111111111111111111---1------------------------------------------------1---------------------1------------------------1-----1111--1-1---------------------1------------111---1----------------111111111111112122111--------------------------------------------------------------- -----------------------------------------------------1-------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 80.1 SQ:SECSTR ##############################HHcccTccccccEEEEETTTEEEEEEHHTTEEEEETTEEEEEEccTTccEEEEEEEGGGccEEcccccccEEEEcccccccccEEEEHHcTccEEEEcGGGEEccccTTcHHHHcccEEEccccccEEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHcccHHHHccTTcHTGGGEEEEEEEEccccTTccEEEEEETTEEEEEEEGGEEEEEEEGGGccccHHHHHHHHHTTccccTTcEEEcccccccccccTcEEEEEETTTEEE####################################### DISOP:02AL 1-7,345-345| PSIPRED ccccccccEEEEEEEEEEEEEEEEEEEcccccEEEEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccccEEEEEccHHHHHHHHHHHHccccccccccccEEEEcccccEEcccccEEcccccccccEEEEEEEEEccccccccHHHHHHHHHEEEEEEEccHHHHHHHHHHccccccccccccccccEEEcHHHccccccccccccEEEEEEccEEEEccccHHHccccHHHHHHHHHccEEEccccEEEEccccccccccccccEEcccccEEEccccccccccccccEEEEEEEEccccEEEEEEEEEEEcc //