[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06971.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->85 PF12091 * DUF3567 5e-29 62.4 %
:HMM:PFM   1->85 PF12091 * DUF3567 5e-41 51.8 85/85  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06971.1 GT:GENE ABF06971.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 92245..92502 GB:FROM 92245 GB:TO 92502 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF06971.1 GB:DB_XREF GI:93352882 LENGTH 85 SQ:AASEQ MQMIYNSDNYCIVEFGADVEHATLASGGYEIVDKNLKREIFLGGLMAETFRADVTRLIESEPSVEEVDEFLGKFDTVMNNPLVMH GT:EXON 1|1-85:0| RP:PFM:NREP 1 RP:PFM:REP 1->85|PF12091|5e-29|62.4|85/85|DUF3567| HM:PFM:NREP 1 HM:PFM:REP 1->85|PF12091|5e-41|51.8|85/85|DUF3567| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11111111111111111111--111111--------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccEEEccccEEEEEEcccccccHHHHcccEEEEcccccEEEEcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccc //