[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06975.1
DDBJ      :             cell wall surface anchor family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06975.1 GT:GENE ABF06975.1 GT:PRODUCT cell wall surface anchor family protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 97386..97724 GB:FROM 97386 GB:TO 97724 GB:DIRECTION + GB:PRODUCT cell wall surface anchor family protein GB:PROTEIN_ID ABF06975.1 GB:DB_XREF GI:93352886 LENGTH 112 SQ:AASEQ MNKLLISLSALSIAAASSLAMAQGTGATAGTAGTQAGVGAAVNAPSLQTGTGASVNASGGAVTPGASADGGTGAQMDAPKGHQGKQAKGKSKKGETSESSASAGGQAGTKMQ GT:EXON 1|1-112:0| TM:NTM 1 TM:REGION 4->22| SEG 4->20|llislsalsiaaassla| SEG 22->42|aqgtgatagtagtqagvgaav| SEG 80->110|kghqgkqakgkskkgetsessasaggqagtk| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,71-113| PSIPRED ccEEEEEEEHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccc //