[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06980.1
DDBJ      :             protein of unknown function DUF883, ElaB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->137 PF05957 * DUF883 2e-19 39.1 92/94  
:HMM:PFM   7->60 PF01765 * RRF 0.00058 22.2 54/165  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06980.1 GT:GENE ABF06980.1 GT:PRODUCT protein of unknown function DUF883, ElaB GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 101101..101535 GB:FROM 101101 GB:TO 101535 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF883, ElaB GB:PROTEIN_ID ABF06980.1 GB:DB_XREF GI:93352891 InterPro:IPR010279 LENGTH 144 SQ:AASEQ MLTQNPKVRKEINHLHDSADAAVRQIRHAARDTRDAARDAAGPVSEDVKALIGQLQQTIDVLAREGSAESLAAGRRLRDRAQELAERLRERGRDGMDWARVHVDDAVDHSRQRVVESPLMAVGIAALVGAFVGLLLAGGRRSDD GT:EXON 1|1-144:0| TM:NTM 1 TM:REGION 116->137| SEG 29->41|aardtrdaardaa| SEG 75->95|rrlrdraqelaerlrergrdg| SEG 121->139|avgiaalvgafvglllagg| HM:PFM:NREP 2 HM:PFM:REP 46->137|PF05957|2e-19|39.1|92/94|DUF883| HM:PFM:REP 7->60|PF01765|0.00058|22.2|54/165|RRF| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,37-37,68-75,77-78,86-89,140-145| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //