[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06984.1
DDBJ      :             DSBA oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  265/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->209 3hd5C PDBj 2e-32 42.8 %
:RPS:PDB   30->204 1bedA PDBj 2e-27 27.9 %
:RPS:SCOP  44->210 1a2jA  c.47.1.13 * 1e-13 22.8 %
:HMM:SCOP  26->210 1fvkA_ c.47.1.13 * 3.3e-43 33.7 %
:RPS:PFM   49->194 PF01323 * DSBA 4e-08 29.8 %
:HMM:PFM   50->89 PF01323 * DSBA 1.5e-05 33.3 39/193  
:HMM:PFM   97->184 PF01323 * DSBA 1.4e-14 22.7 88/193  
:BLT:SWISS 32->212 DSBA_BURCE 2e-64 60.8 %
:PROS 50->68|PS00194|THIOREDOXIN_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06984.1 GT:GENE ABF06984.1 GT:PRODUCT DSBA oxidoreductase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 105279..105917 GB:FROM 105279 GB:TO 105917 GB:DIRECTION + GB:PRODUCT DSBA oxidoreductase GB:PROTEIN_ID ABF06984.1 GB:DB_XREF GI:93352895 InterPro:IPR001853 InterPro:IPR006662 InterPro:IPR006663 LENGTH 212 SQ:AASEQ MKKIAALLATVAAVSGLLMTAPAAMAAPTEGKDYTVLKSPQPVPAGKIEVTEFFWYGCPHCYDFEPELEAWVKKQGKDVVFKRVPVAFRDDLLPHTKIFYALEAMGKLDAMHTKVFDAIHKQRKRLLTTDEIADFMAQNGIDKKQWLDTYNSFSVTTNSQRANKIADAYKIDGVPTVVVQGKYETSPSIAGTKPGAIQAMDFLVTGVRDKKL GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 32->212|DSBA_BURCE|2e-64|60.8|181/212| PROS 50->68|PS00194|THIOREDOXIN_1|PDOC00172| SEG 17->29|llmtapaamaapt| BL:PDB:NREP 1 BL:PDB:REP 32->209|3hd5C|2e-32|42.8|173/176| RP:PDB:NREP 1 RP:PDB:REP 30->204|1bedA|2e-27|27.9|172/181| RP:PFM:NREP 1 RP:PFM:REP 49->194|PF01323|4e-08|29.8|141/178|DSBA| HM:PFM:NREP 2 HM:PFM:REP 50->89|PF01323|1.5e-05|33.3|39/193|DSBA| HM:PFM:REP 97->184|PF01323|1.4e-14|22.7|88/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 44->210|1a2jA|1e-13|22.8|167/188|c.47.1.13| HM:SCP:REP 26->210|1fvkA_|3.3e-43|33.7|181/188|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 328 OP:NHOMOORG 266 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111112111211111111111111112233333111111-----------------------------------------------------------111111111231222211322221233222--111-1------11-111-1111111111-11111111111111-1111111-111-1111111111111111-1111111--111111111111--11-----1111111112112-212222111111111111111111111111111111111---------11221111111222222223221222222111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 85.8 SQ:SECSTR #############################cTTTEEEccccccccccccEEEEEEcTTcHHHHHHHHHHHHHHHTccTTcEEEEEEccccGGHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHTcccccEEEETTTEEEcGGGcccHHHHHHHHHHHHHHHHHHH# DISOP:02AL 1-1,211-213| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEccEEEEcccccccHHHHHHHHHHHHHHHHHccc //