[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF06997.1
DDBJ      :             phage tail protein I
Swiss-Prot:Y111_RALME   RecName: Full=UPF0225 protein Rmet_0111;

Homologs  Archaea  0/68 : Bacteria  313/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->136 2jq5A PDBj 3e-11 39.5 %
:RPS:SCOP  33->137 2i9wA1  d.17.4.30 * 7e-38 31.4 %
:BLT:SWISS 1->141 Y111_RALME 2e-85 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF06997.1 GT:GENE ABF06997.1 GT:PRODUCT phage tail protein I GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 117745..118170 GB:FROM 117745 GB:TO 118170 GB:DIRECTION + GB:PRODUCT phage tail protein I GB:PROTEIN_ID ABF06997.1 GB:DB_XREF GI:93352908 LENGTH 141 SQ:AASEQ MTNKGRAGTGPAPCPCGNGAYDTCCGRFHRGEASPPTAEALMRSRYSAYVLGDVSWLRQTWHASTCPPDLSADPGTNWLGLTVKSHAQQDATHATVEFVARYKVGGRAHRLHELSRFVFESREPGEASRWLYVDGDLREPA GT:EXON 1|1-141:0| SW:ID Y111_RALME SW:DE RecName: Full=UPF0225 protein Rmet_0111; SW:GN OrderedLocusNames=Rmet_0111; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->141|Y111_RALME|2e-85|100.0|141/141| BL:PDB:NREP 1 BL:PDB:REP 14->136|2jq5A|3e-11|39.5|114/128| RP:SCP:NREP 1 RP:SCP:REP 33->137|2i9wA1|7e-38|31.4|105/113|d.17.4.30| OP:NHOMO 320 OP:NHOMOORG 317 OP:PATTERN -------------------------------------------------------------------- ----1111111----------1---1------11111111---11-11111111111-----111--111-----------------------------1--1-------------------------------------------1----------1111--1-------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------11---1-11-----------------------1-----------------------------------------211-----------------------------------111111111111111111111111111111111--1111111111111-11-1111111--------11111-1-1--11-1111-1111111-1----11----------------------1-111--11-111111-1121111111111111-111---1--1--------111111111111111-1111111111111111111-11111111-111111111-1-11111111111-111111111111---1-----111111111111111-1111----1111111--11111111111111111111---------1111111111-11111111111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12----1--------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 87.2 SQ:SECSTR #############cccccccHHHHHHHHHTTccccccHHHHHHHHHHHHHTTcHHHHHHTccHHHTTHTTcHHHHHHHEEEEEEEEEEEcTTEEEEEEEEEEEEccccEEEEEEEEEEEEEccEEETTEEEEEEEE##### DISOP:02AL 1-14,139-142| PSIPRED ccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEEccccccccEEEEEcccccccc //