[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07005.1
DDBJ      :             YbaK/prolyl-tRNA synthetase associated region
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  181/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->161 2cx5A PDBj 5e-29 46.4 %
:RPS:PDB   7->161 2cx5A PDBj 2e-24 44.4 %
:RPS:SCOP  12->161 1wdvA  d.116.1.1 * 6e-26 29.5 %
:HMM:SCOP  12->161 1wdvA_ d.116.1.1 * 4.4e-31 32.9 %
:RPS:PFM   35->135 PF04073 * YbaK 3e-09 35.0 %
:HMM:PFM   34->149 PF04073 * YbaK 9.5e-29 34.2 114/123  
:BLT:SWISS 24->156 YWHH_BACSU 3e-15 32.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07005.1 GT:GENE ABF07005.1 GT:PRODUCT YbaK/prolyl-tRNA synthetase associated region GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 125870..126367 GB:FROM 125870 GB:TO 126367 GB:DIRECTION + GB:PRODUCT YbaK/prolyl-tRNA synthetase associated region GB:PROTEIN_ID ABF07005.1 GB:DB_XREF GI:93352916 InterPro:IPR007214 LENGTH 165 SQ:AASEQ MSESPTLPDAAQRVADLLVGIGHDRPVVMLPATGKTSAEAAAGLGCTVAEIAKSIIFRRVEDDVPVLVIASGSNRVDEAKVAARVGALGKADAKFVREKTGYAIGGVCPIGHAVAPVMLLDQDLFQYDSVWAAAGHPHAVFNLTPQQLQAMTGAEVADVAQVTSA GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 24->156|YWHH_BACSU|3e-15|32.6|132/157| BL:PDB:NREP 1 BL:PDB:REP 6->161|2cx5A|5e-29|46.4|153/157| RP:PDB:NREP 1 RP:PDB:REP 7->161|2cx5A|2e-24|44.4|153/157| RP:PFM:NREP 1 RP:PFM:REP 35->135|PF04073|3e-09|35.0|100/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 34->149|PF04073|9.5e-29|34.2|114/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 12->161|1wdvA|6e-26|29.5|149/150|d.116.1.1| HM:SCP:REP 12->161|1wdvA_|4.4e-31|32.9|149/0|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 192 OP:NHOMOORG 184 OP:PATTERN ------------------------------11------------------------------------ ----1---------1----------1----------111111--11------111--1--111-1--1111---------1-1--------------------------------------------------------------1----------------------------------------11--1-----------------------1------1---------1---------------------------------------------------------------------------------------------1--1111-11----1------------1-1-11-111-11---1------------------111---11-1-1111111-111------1-1-1--1111111111111----1111-11--111111111111-1-11-----------------------------1--1-1-11-11121211111111112222121111111--11111111111111--1----11--------------------------1-1-1------------------------------------------------------------------------------------11-------------------------------------------1111111111111111--------------------------------1----------------------------------1121----1--------------------------------------------------------------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 94.5 SQ:SECSTR #####cccHHHHHHHHHHHHTTTTccEEEccTTcccHHHHHHHHTccGGGEEEEEEEEETccccEEEEEEETTccccHHHHHHHHTccEEccHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTEEEEEcHHHHHHHHccEEEcccc#### DISOP:02AL 1-11,164-166| PSIPRED ccccccccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHccccHHHEEEEEEEEEccccEEEEEEEcccccccHHHHHHHccccccccHHHHHHHHccccccccccccccccEEEEEHHHHccccEEEEccccccEEEEcHHHHHHHHccEEEEEEEEEcc //