[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF07014.1
DDBJ      :             putative ferric uptake regulator, FUR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->161 2rgvB PDBj 2e-06 31.1 %
:RPS:PDB   27->102 2co5B PDBj 2e-05 9.6 %
:RPS:SCOP  27->158 1mzbA  a.4.5.42 * 5e-16 25.8 %
:HMM:SCOP  22->158 1mzbA_ a.4.5.42 * 6.1e-24 29.5 %
:RPS:PFM   30->124 PF01475 * FUR 3e-09 40.5 %
:RPS:PFM   100->162 PF07255 * Benyvirus_14KDa 1e-04 27.0 %
:HMM:PFM   31->150 PF01475 * FUR 4.8e-12 25.9 112/120  
:BLT:SWISS 27->162 FUR_MYCTU 2e-07 33.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF07014.1 GT:GENE ABF07014.1 GT:PRODUCT putative ferric uptake regulator, FUR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(134333..134842) GB:FROM 134333 GB:TO 134842 GB:DIRECTION - GB:PRODUCT putative ferric uptake regulator, FUR family GB:PROTEIN_ID ABF07014.1 GB:DB_XREF GI:93352925 InterPro:IPR002481 LENGTH 169 SQ:AASEQ MTRTTPHAAASDDAVMPGDPLATAQLRLRQLGARVTQPRLAILACLIEAPEPLTHQAVIDHLPAEGDVDRVTVYRVLDWLVDQGLAQKRAGNDRVFRFSLVEHEAARAEVHRQHSHFHCTRCDRTFCLESAGKSVAPRVPNGFAVEHVELTVNGICAECGRSHGDASAH GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 27->162|FUR_MYCTU|2e-07|33.6|125/147| BL:PDB:NREP 1 BL:PDB:REP 32->161|2rgvB|2e-06|31.1|119/140| RP:PDB:NREP 1 RP:PDB:REP 27->102|2co5B|2e-05|9.6|73/94| RP:PFM:NREP 2 RP:PFM:REP 30->124|PF01475|3e-09|40.5|84/120|FUR| RP:PFM:REP 100->162|PF07255|1e-04|27.0|63/123|Benyvirus_14KDa| HM:PFM:NREP 1 HM:PFM:REP 31->150|PF01475|4.8e-12|25.9|112/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 27->158|1mzbA|5e-16|25.8|124/133|a.4.5.42| HM:SCP:REP 22->158|1mzbA_|6.1e-24|29.5|129/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 45 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111---------1---1-1-1--------------1-----------------------------------------------1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------2111--111---------1-111-11----------1-111-------11---111--------------11-1-------------------------11-------------------------------------------1--------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 79.9 SQ:SECSTR ##########################ccTTccccHHHHHHHHHHHHTTTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTTccEEEEcHccHHHHHHTcccccEEEccEEccEEcccccHHHHHHHHHcccccccEEEEEEccHHHHH######## DISOP:02AL 1-15,158-170| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccEEEEEEcccccHHccccccccEEEEcccccEEEcccccHHHHHHHHcccEEEEEEEEEEEEcHHHHHcccccccc //